Result : O31441
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YbyB |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 230819 |
| Right | 231079 |
| Strand | - |
| Nucleotide Sequence | ATGAAACAAAAGCTGTTACTTTCAGGTCTCGCTGTTTCAACTGTCGGCATCACTTCTTATCTATTAAAAGACCCGTCAAATCGCCAAAAGGCAAGAGAATTCATTCACAGCATGAAGATGAAAATAACAAAACAGCCAGACATGGAAACGTTCCCAGTTGATAAAGCCGGCCACCCGGACCCGCAAGATATCGAGGACAACAAAATGGTATCAGAAGGCTCCATGTATCCCGTCCAATACTACGATGAAAAAAAGAAGTAA |
| Sequence | MKQKLLLSGLAVSTVGITSYLLKDPSNRQKAREFIHSMKMKITKQPDMETFPVDKAGHPDPQDIEDNKMVSEGSMYPVQYYDEKKK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31441 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 230819 | 231079 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 232661 | 232921 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1785948 | 1786208 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 224149 | 224409 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 223973 | 224233 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 366201 | 366461 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 191996 | 192256 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 8 | 3708586 | 3708846 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 258693 | 258953 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 208221 | 208487 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 246221 | 246487 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 220167 | 220415 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 3079354 | 3079605 | - | NZ_CP016020.1 | Bacillus weihaiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00324.23 | 0.69 | 9 | 1184.0 | opposite-strand | Amino acid permease |
| 2 | PF13520.8 | 0.69 | 9 | 1184.0 | opposite-strand | Amino acid permease |
| 3 | PF17334.4 | 0.92 | 12 | 2118.5 | opposite-strand | Minor curli fiber component A |
| 4 | PF17340.4 | 0.69 | 9 | 2292 | opposite-strand | Family of unknown function (DUF5370) |
| 5 | PF03009.19 | 0.69 | 9 | 2011 | same-strand | Glycerophosphoryl diester phosphodiesterase family |
| 6 | PF07690.18 | 0.77 | 10 | 2915 | same-strand | Major Facilitator Superfamily |
| 7 | PF10852.10 | 0.69 | 9 | 4552 | opposite-strand | Protein of unknown function (DUF2651) |
++ More..