Result : O31422
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sporulation killing factor (SKF) (Sporulation-killing factor SkfA) |
| NCBI Accession ID | AB006424.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 16922 |
| Right | 17089 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAGAAACCAAAAAGAATGGGAATCTGTGAGTAAAAAAGGACTTATGAAGCCGGGAGGTACTTCGATTGTGAAAGCTGCTGGCTGCATGGGCTGTTGGGCCTCGAAGAGTATTGCTATGACACGTGTTTGTGCACTTCCGCATCCTGCTATGAGAGCTATTTAA |
| Sequence | MKRNQKEWESVSKKGLMKPGGTSIVKAAGCMGCWASKSIAMTRVCALPHPAMRAI |
| Source of smORF | Swiss-Prot |
| Function | Produces a 26-residue extracellular sporulation filling factor (SKF) that induces the lysis of other B.subtilis cells that have not entered the sporulation pathway, providing a source of nutrients to support sporulation, and at the same time delaying commitment to the energetically expensive and irreversible onset of sporulation (Pubmed:12817086, Pubmed:20805502). Can also inhibit growth of other bacteria at high concentrations (Pubmed:11851812). Addition of SKF to solid cultures induces killing, but it is much less effective than SDP (AC O34344) (Pubmed:20805502). Has a role in protecting the secreted lipase LipA against proteolysis, either by modulating its folding or by acting as a protease inhibitor (Pubmed:15812018). {ECO:0000269|Pubmed:11851812, ECO:0000269|Pubmed:12817086, ECO:0000269|Pubmed:15812018, ECO:0000269|Pubmed:20805502}. |
| Pubmed ID | 9384377 20805502 11851812 12817086 15812018 15687200 16816204 17720793 23282011 |
| Domain | CDD:275197 |
| Functional Category | Antimicrobial |
| Uniprot ID | O31422 |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 213941 | 214108 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 209792 | 209959 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 263474 | 263641 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 4 | 1323652 | 1323819 | - | NZ_CP017703.1 | Aeribacillus pallidus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048852.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04055.23 | 1.0 | 4 | 67.0 | same-strand | Radical SAM superfamily |
| 2 | PF02517.18 | 1.0 | 4 | 1295.5 | same-strand | Type II CAAX prenyl endopeptidase Rce1-like |
| 3 | PF00005.29 | 1.0 | 4 | 2804.0 | same-strand | ABC transporter |
| 4 | PF13646.8 | 0.75 | 3 | 5022 | same-strand | HEAT repeats |
++ More..