Result : O31417
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized HTH-type transcriptional regulator YazB |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 87401 |
| Right | 87610 |
| Strand | + |
| Nucleotide Sequence | ATGGAAGCAGAAATCTGGGGTAGACGAATTCGTGCATTCAGAAAGCTGAAAGGTTATACTCAAGAAGGATTTGCAAAAGCATTAGGTATATCAGTTTCTATTCTCGGCGAAATTGAACGCGGAAACCGATTGCCGTCTGCTGCCATCATTCAAGATGCAGCAGATGTTTTAAATATAAGTGCGGACGAATTGGCGCCGCCAGAAAAATAG |
| Sequence | MEAEIWGRRIRAFRKLKGYTQEGFAKALGISVSILGEIERGNRLPSAAIIQDAADVLNISADELAPPEK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
| Pubmed ID | 9384377 |
| Domain | CDD:419869 |
| Functional Category | DNA-binding |
| Uniprot ID | O31417 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 81
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 87401 | 87610 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 67662 | 67880 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 87088 | 87306 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 88376 | 88585 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 5 | 87276 | 87485 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 3842957 | 3843166 | - | NZ_CP011937.1 | Bacillus velezensis |
| 7 | 1922109 | 1922327 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 87091 | 87309 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 9 | 223236 | 223454 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 10 | 2746299 | 2746517 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 11 | 2001575 | 2001799 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 12 | 3217688 | 3217909 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 13 | 118860 | 119069 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 14 | 92233 | 92442 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 15 | 101754 | 101990 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 16 | 94886 | 95095 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 17 | 530227 | 530445 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 18 | 1541847 | 1542080 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 19 | 66452 | 66685 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 20 | 1458818 | 1459051 | - | NZ_CP043404.1 | Bacillus safensis |
| 21 | 2483200 | 2483412 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 22 | 84668 | 84889 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 23 | 2778266 | 2778487 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 24 | 188005 | 188226 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 25 | 2311465 | 2311686 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 26 | 3144741 | 3144962 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 27 | 2530546 | 2530758 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 28 | 79482 | 79685 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 29 | 79081 | 79284 | + | NC_011725.1 | Bacillus cereus B4264 |
| 30 | 1805491 | 1805709 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 31 | 5040497 | 5040700 | - | NZ_CP040336.1 | Bacillus luti |
| 32 | 79166 | 79369 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 33 | 78899 | 79102 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 34 | 4099652 | 4099855 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 35 | 398324 | 398545 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 36 | 88814 | 89029 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 37 | 78809 | 79012 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 38 | 91609 | 91824 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 39 | 83470 | 83679 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 40 | 1123022 | 1123237 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 41 | 89355 | 89561 | + | NZ_CP012024.1 | Bacillus smithii |
| 42 | 4686005 | 4686214 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 43 | 202210 | 202425 | + | NZ_CP053989.1 | Niallia circulans |
| 44 | 114147 | 114368 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 45 | 81047 | 81268 | + | NZ_LS483476.1 | Lederbergia lentus |
| 46 | 1570419 | 1570625 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 47 | 74668 | 74892 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 48 | 84920 | 85147 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 49 | 97667 | 97873 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 50 | 93866 | 94069 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 51 | 102113 | 102322 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 52 | 123632 | 123859 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 53 | 77247 | 77444 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 54 | 98420 | 98623 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 55 | 91494 | 91706 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 56 | 75667 | 75861 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 57 | 1987691 | 1987885 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 58 | 1947767 | 1947961 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 59 | 75116 | 75310 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 60 | 1474023 | 1474226 | - | NZ_CP011388.1 | Paenibacillus swuensis |
| 61 | 75378 | 75572 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 62 | 2126551 | 2126778 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 63 | 857121 | 857330 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 64 | 3890870 | 3891079 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 65 | 7136567 | 7136761 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 66 | 87481 | 87675 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 67 | 242355 | 242567 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 68 | 91501 | 91719 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 69 | 89145 | 89375 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 70 | 2308361 | 2308588 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 71 | 80642 | 80854 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 72 | 8421883 | 8422113 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 73 | 937422 | 937619 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 74 | 81921 | 82124 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 75 | 74984 | 75181 | + | NZ_CP009288.1 | Paenibacillus durus |
| 76 | 3130526 | 3130741 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 77 | 74732 | 74929 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 78 | 3862994 | 3863188 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 79 | 3705829 | 3706023 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 80 | 4103619 | 4103819 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 81 | 1673528 | 1673719 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00117.30 | 0.85 | 69 | 2553 | same-strand | Glutamine amidotransferase class-I |
| 2 | PF01063.21 | 0.81 | 66 | 1683.0 | same-strand | Amino-transferase class IV |
| 3 | PF00809.24 | 1.0 | 81 | 834 | same-strand | Pterin binding enzyme |
| 4 | PF02152.20 | 1.0 | 81 | 479 | same-strand | Dihydroneopterin aldolase |
| 5 | PF01288.22 | 1.0 | 81 | -48 | same-strand | 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) |
| 6 | PF01207.19 | 0.9 | 73 | 24 | same-strand | Dihydrouridine synthase (Dus) |
| 7 | PF00152.22 | 1.0 | 81 | 1183 | same-strand | tRNA synthetases class II (D, K and N) |
| 8 | PF01336.27 | 0.99 | 80 | 1182.5 | same-strand | OB-fold nucleic acid binding domain |
++ More..