ProsmORF-pred
Result : O31414
Protein Information
Information Type Description
Protein name UPF0213 protein YazA
NCBI Accession ID AL009126.3
Organism Bacillus subtilis (strain 168)
Left 43647
Right 43946
Strand +
Nucleotide Sequence ATGGAGACAAATAACCATTTCTTCTACGTCGTGAAATGTAAGGACAATAGCTGGTATGCCGGGTATACCAACGATCTGCATAAACGAGTGAAAACGCACAATGATGGAAAGGGCGCAAAGTACACAAAAGTAAGACGTCCGGTTGAATTAATTTTTGCCGAGAGCTTTTCAACAAAGCGGGAAGCTATGCAGGCGGAATATTATTTCAAAAAACTAACTCGGAAGAAAAAAGAGCTTTATATAGAAGAAAAGCGGAACAGCAAGGAGGCTGTATATGTTAAGGCGCCAAATGAGCTTTAA
Sequence METNNHFFYVVKCKDNSWYAGYTNDLHKRVKTHNDGKGAKYTKVRRPVELIFAESFSTKREAMQAEYYFKKLTRKKKELYIEEKRNSKEAVYVKAPNEL
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl15257. Profile Description: GIY-YIG nuclease domain superfamily. This domain was identified by Iyer and colleagues.
Pubmed ID 9384377
Domain CDD:417687
Functional Category Others
Uniprot ID O31414
ORF Length (Amino Acid) 99
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 140
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 43647 43946 + NC_000964.3 Bacillus subtilis subsp. subtilis str. 168
2 23905 24204 + NZ_CP013984.1 Bacillus inaquosorum
3 43334 43633 + NZ_CP034943.1 Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499
4 43322 43621 + NZ_CP048852.1 Bacillus tequilensis
5 43347 43646 + NZ_CP051464.1 Bacillus mojavensis
6 1965777 1966076 - NZ_CP029364.1 Bacillus halotolerans
7 179483 179782 + NZ_CP033052.1 Bacillus vallismortis
8 3886494 3886793 - NZ_CP011937.1 Bacillus velezensis
9 44755 45054 + NZ_CP053376.1 Bacillus amyloliquefaciens
10 47843 48136 + NZ_LT603683.1 Bacillus glycinifermentans
11 48121 48414 + NC_006270.3 Bacillus licheniformis DSM 13 = ATCC 14580
12 74740 75033 + NZ_CP023665.1 Bacillus paralicheniformis
13 1502668 1502967 - NZ_CP043404.1 Bacillus safensis
14 1585718 1586017 - NZ_CP017786.1 Bacillus xiamenensis
15 22510 22809 + NZ_CP011150.1 Bacillus altitudinis
16 1805182 1805445 - NZ_CP015108.1 Sporosarcina ureae
17 4641188 4641466 - NZ_CP014616.1 Sporosarcina psychrophila
18 4640563 4640844 + NZ_CP018866.1 Sutcliffiella cohnii
19 46652 46939 + NZ_CP024035.1 Priestia aryabhattai
20 39581 39871 + NC_011725.1 Bacillus cereus B4264
21 154785 155072 + NZ_CP053989.1 Niallia circulans
22 52477 52746 + NZ_CP009416.1 Jeotgalibacillus malaysiensis
23 2483441 2483701 + NZ_CP030926.1 Peribacillus butanolivorans
24 2788711 2788968 - NZ_CP068053.1 Peribacillus psychrosaccharolyticus
25 45936 46205 + NZ_CP019401.1 Planococcus faecalis
26 1716667 1716936 - NZ_CP013661.2 Planococcus kocurii
27 43815 44087 + NZ_CP016538.2 Planococcus maritimus
28 39627 39896 + NZ_CP016540.2 Planococcus versutus
29 65351 65620 + NZ_CP016543.2 Planococcus donghaensis
30 44881 45150 + NZ_CP016537.2 Planococcus halocryophilus
31 39291 39581 + NZ_CP064875.1 Bacillus toyonensis
32 38154 38438 + NZ_CP023704.1 Caldibacillus thermoamylovorans
33 39893 40183 + NZ_CP024109.1 Bacillus cytotoxicus
34 2530063 2530323 - NZ_CP017704.1 Peribacillus simplex NBRC 15720 = DSM 1321
35 1851317 1851604 - NZ_CP041305.1 Cytobacillus ciccensis
36 45535 45822 + NC_022524.1 Bacillus infantis NRRL B-14911
37 5079982 5080272 - NZ_CP040336.1 Bacillus luti
38 39276 39566 + NZ_CP032365.1 Bacillus wiedmannii
39 39668 39958 + NC_007530.2 Bacillus anthracis str. 'Ames Ancestor'
40 31225 31515 + NZ_CP015378.1 Fictibacillus phosphorivorans
41 43721 43993 + NZ_CP059540.1 Planococcus maritimus
42 1156925 1157215 + NZ_CP023392.1 Lactococcus raffinolactis
43 746316 746600 - NZ_CP011856.1 Spiroplasma eriocheiris
44 2177895 2178173 + NC_020995.1 Enterococcus casseliflavus EC20
45 46207 46476 + NZ_CP016534.2 Planococcus antarcticus DSM 14505
46 1829115 1829387 + NZ_CP022680.1 Streptococcus respiraculi
47 890222 890509 + NZ_CP047141.1 Ligilactobacillus animalis
48 2155550 2155816 - NZ_CP017195.1 Lactococcus paracarnosus
49 67694 67960 + NZ_CP017194.1 Lactococcus carnosus
50 498836 499123 - NZ_LS483306.1 Enterococcus cecorum
51 118982 119269 + NZ_CP015196.1 Streptococcus marmotae
52 3231772 3232044 + NZ_CP013659.2 Planococcus rifietoensis
53 2255119 2255367 - NZ_LR134242.1 Staphylococcus warneri
54 1674226 1674474 + NC_022737.1 Staphylococcus pasteuri SP1
55 2338392 2338640 + NZ_CP068061.1 Mammaliicoccus vitulinus
56 2048788 2049057 - NZ_CP022983.1 Cytobacillus kochii
57 1020518 1020781 - NZ_CP036170.1 [Clostridium] scindens ATCC 35704
58 493381 493653 - NZ_CP060720.1 Vagococcus carniphilus
59 620456 620740 - NZ_CP002082.1 Spiroplasma mirum ATCC 29335
60 648338 648622 - NZ_CP011855.1 Spiroplasma atrichopogonis
61 583646 583891 - NZ_CP039457.1 Streptococcus pasteurianus
62 2986050 2986313 + NZ_LT635479.1 Lachnoclostridium phocaeense
63 43337 43609 + NZ_CP016539.2 Planococcus plakortidis
64 46365 46634 + NC_013791.2 Alkalihalobacillus pseudofirmus OF4
65 1465817 1466089 - NZ_CP054015.1 Streptococcus gallolyticus
66 850302 850577 - NZ_CP026116.1 Latilactobacillus curvatus JCM 1096 = DSM 20019
67 1304359 1304640 + NZ_CP049889.1 Jeotgalibaca porci
68 4146863 4147144 - NZ_CP016020.1 Bacillus weihaiensis
69 2047149 2047412 + NZ_CP017267.1 Vagococcus teuberi
70 51640 51951 + NZ_CP023434.1 Suicoccus acidiformans
71 578911 579165 + NZ_CP032626.1 Apilactobacillus bombintestini
72 270082 270330 + NZ_CP013114.1 Staphylococcus equorum
73 2280650 2280898 + NZ_CP007601.1 Staphylococcus capitis subsp. capitis
74 2359443 2359718 + NZ_CP023074.1 Enterococcus thailandicus
75 1411347 1411637 - NZ_CP027783.1 Tetragenococcus osmophilus
76 2634415 2634708 - NZ_CP013862.1 Lentibacillus amyloliquefaciens
77 2339117 2339365 - NZ_LT906462.1 Mammaliicoccus stepanovicii
78 2338325 2338573 - NZ_CP035288.1 Staphylococcus epidermidis
79 1505032 1505301 + NC_017581.1 Streptococcus thermophilus JIM 8232
80 3109549 3109794 - NZ_CP068170.1 Erysipelatoclostridium ramosum
81 2329533 2329781 - NZ_LR134089.1 Staphylococcus saprophyticus
82 962315 962596 + NZ_CP014872.1 Fructilactobacillus lindneri
83 532334 532609 - NZ_LS483403.1 Streptococcus lutetiensis
84 1387149 1387430 + NZ_CP065061.1 Streptococcus equi subsp. zooepidemicus
85 121048 121323 - NZ_CP046037.1 Latilactobacillus sakei
86 1855493 1855783 + NZ_CP012047.1 Tetragenococcus halophilus
87 1989596 1989838 - NZ_CP018906.1 Lentilactobacillus curieae
88 2456203 2456451 - NZ_CP008724.1 Staphylococcus xylosus
89 944264 944578 - NZ_CP029476.1 Lactobacillus apis
90 2461609 2461857 - NZ_AP018587.1 Staphylococcus caprae
91 66372 66638 - NZ_AP024085.1 Faecalibacillus intestinalis
92 1456137 1456397 + NZ_CP025536.1 Streptococcus pluranimalium
93 1097392 1097673 - NZ_CP023011.2 Enterococcus hirae
94 1919402 1919683 - NC_008261.1 Clostridium perfringens ATCC 13124
95 612538 612810 - NZ_AP018400.1 Streptococcus ruminantium
96 1628973 1629221 - NZ_CP018199.1 Staphylococcus succinus
97 1279059 1279307 - NZ_CP014022.1 Staphylococcus lugdunensis
98 1121835 1122104 - NZ_CP024610.1 Lactobacillus terrae
99 208200 208466 + NZ_CP009577.1 Listeria ivanovii subsp. ivanovii
100 460343 460591 + NC_007795.1 Staphylococcus aureus subsp. aureus NCTC 8325
101 749828 750076 - NZ_CP031733.1 Streptococcus chenjunshii
102 2109845 2110150 + NZ_CP039712.1 Vagococcus zengguangii
103 1495078 1495320 + NC_012924.1 Streptococcus suis SC84
104 476305 476553 + NZ_LT906460.1 Staphylococcus simiae
105 53415 53687 + NC_017668.1 Halobacillus halophilus DSM 2266
106 914993 915244 - NZ_CP071376.1 Clostridium gasigenes
107 36420 36707 + NZ_LS483476.1 Lederbergia lentus
108 547447 547701 - NZ_LS483343.1 Streptococcus ferus
109 1520929 1521180 + NZ_AP014612.1 Streptococcus troglodytae
110 395262 395522 + NC_014387.1 Butyrivibrio proteoclasticus B316
111 631980 632225 - NZ_CP029491.1 Streptococcus sobrinus
112 1305571 1305816 + NZ_LS483436.1 Streptococcus intermedius
113 314291 314542 + NZ_CP065712.1 Staphylococcus auricularis
114 690846 691106 + NZ_LR134341.1 Streptococcus pseudoporcinus
115 264600 264893 - NZ_CP022437.1 Virgibacillus necropolis
116 64726 64998 + NC_002570.2 Alkalihalobacillus halodurans C-125
117 1215495 1215764 + NZ_CP023643.1 Brochothrix thermosphacta
118 165522 165764 + NC_003210.1 Listeria monocytogenes EGD-e
119 2229524 2229814 + NZ_CP009709.1 Weizmannia coagulans DSM 1 = ATCC 7050
120 533011 533271 - NZ_LT906439.1 Streptococcus merionis
121 76035 76298 - NZ_CP021874.1 Enterococcus wangshanyuanii
122 154500 154742 + NZ_CP043405.1 Streptococcus ratti
123 1955032 1955280 + NZ_CP022096.2 Staphylococcus pettenkoferi
124 3069739 3070002 - NZ_CP011102.1 Listeria weihenstephanensis
125 553288 553539 + NZ_CP011403.1 Ligilactobacillus salivarius str. Ren
126 1313837 1314094 + NZ_CP034543.1 Streptococcus periodonticum
127 1338538 1338786 - NZ_CP031305.1 Natronorubrum bangense
128 673391 673636 - NZ_LS483383.1 Streptococcus cristatus ATCC 51100
129 1329079 1329336 + NZ_CP012805.1 Streptococcus anginosus
130 1100484 1100771 - NZ_LN898144.1 Paucilactobacillus oligofermentans DSM 15707 = LMG 22743
131 1725 1979 + NZ_CP016953.1 Streptococcus himalayensis
132 903237 903536 - NZ_CP065637.1 Lactococcus garvieae
133 1273971 1274222 - NZ_LR134293.1 Streptococcus canis
134 1449062 1449340 + NZ_LR594046.1 Streptococcus dysgalactiae
135 2328254 2328505 - NZ_CP064056.1 Staphylococcus lloydii
136 1399771 1400055 + NZ_CP017713.1 Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001
137 1513271 1513570 + NZ_CP032627.1 Lactococcus allomyrinae
138 1107016 1107294 + NZ_CP010450.1 Streptococcus pyogenes
139 496793 497056 + NZ_CP032364.1 Lachnoanaerobaculum umeaense
140 39025 39306 + NC_018704.1 Amphibacillus xylanus NBRC 15112
141 527615 527878 + NZ_CP016757.1 Cloacibacillus porcorum
++ More..