Result : O31178
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Transcriptional repressor PagR (Protective antigen repressor) |
| NCBI Accession ID | AF031382.1 |
| Organism | Bacillus anthracis |
| Left | 833 |
| Right | 1132 |
| Strand | + |
| Nucleotide Sequence | ATGACAGTATTTGTAGATCATAAAATTGAATACATGAGTTTAGAAGATGATGCTGAACTTTTAAAAACAATGGCACATCCTATGCGTTTAAAAATAGTCAATGAACTTTACAAACATAAAGCATTAAATGTAACGCAAATCATTCAAATCTTAAAACTACCACAATCAACTGTATCCCAGCATTTATGTAAAATGAGAGGAAAAGTTTTAAAAAGAAATCGACAAGGTTTAGAGATATACTATAGCATTAATAATCCAAAAGTTGAAGGGATTATTAAGTTGTTAAACCCTATCCAATAG |
| Sequence | MTVFVDHKIEYMSLEDDAELLKTMAHPMRLKIVNELYKHKALNVTQIIQILKLPQSTVSQHLCKMRGKVLKRNRQGLEIYYSINNPKVEGIIKLLNPIQ |
| Source of smORF | Swiss-Prot |
| Function | Represses the expression of the pagA and atxA genes. |
| Pubmed ID | 10419943 10515943 12004073 18952800 12067380 10475965 |
| Domain | CDD:419669 |
| Functional Category | DNA-binding |
| Uniprot ID | O31178 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 146996 | 147295 | + | NC_007322.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 2 | 174223 | 174489 | - | NC_007322.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 3 | 58442 | 58741 | + | NC_007323.3 | Bacillus anthracis str. 'Ames Ancestor' |
| 4 | 3042523 | 3042822 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 5 | 2199004 | 2199303 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 6 | 2262883 | 2263182 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 7 | 2881922 | 2882221 | - | NZ_CP040336.1 | Bacillus luti |
| 8 | 2233143 | 2233442 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 9 | 3331594 | 3331887 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 10 | 2228461 | 2228760 | + | NC_011725.1 | Bacillus cereus B4264 |
| 11 | 2012892 | 2013182 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 12 | 338095 | 338388 | - | NZ_CP064876.1 | Bacillus toyonensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007530.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10763.11 | 0.67 | 4 | 4963.5 | same-strand | Protein of unknown function (DUF2584) |
| 2 | PF00149.30 | 0.67 | 4 | 3790.5 | same-strand | Calcineurin-like phosphoesterase |
| 3 | PF12320.10 | 0.67 | 4 | 3790.5 | same-strand | Type 5 capsule protein repressor C-terminal domain |
| 4 | PF13476.8 | 0.67 | 4 | 704.5 | same-strand | AAA domain |
| 5 | PF09953.11 | 0.83 | 5 | 59 | opposite-strand | Uncharacterized protein conserved in bacteria (DUF2187) |
| 6 | PF13561.8 | 0.83 | 5 | 3312 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 7 | PF00106.27 | 1.0 | 6 | 3030.5 | same-strand | short chain dehydrogenase |
| 8 | PF08659.12 | 1.0 | 6 | 3030.5 | same-strand | KR domain |
| 9 | PF00425.20 | 0.67 | 4 | 3838.0 | same-strand | chorismate binding enzyme |
++ More..