Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YojW |
NCBI Accession ID | AF012906.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 5807 |
Right | 5974 |
Strand | + |
Nucleotide Sequence | ATGCTTTATAGGAACGGTCTTTGCTTTGGGTTTCTTCAGTTACAAGGACTTGAAGATGAATTTATTGAACATATGAGACAAGTTGCTGAGTACGAGAAAGACCTGAGATACAAGAAGGCAGCAGCTAACTTCATGAAGATGCATGACCAAAACTGGGTGGGGGATTAA |
Sequence | MLYRNGLCFGFLQLQGLEDEFIEHMRQVAEYEKDLRYKKAAANFMKMHDQNWVGD |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9679200 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O30602 |
ORF Length (Amino Acid) | 55 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2158120 | 2158287 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1834139 | 1834294 | + | NZ_CP048852.1 | Bacillus tequilensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00692.21 | 1.0 | 2 | 813.0 | same-strand | dUTPase |
2 | PF13192.8 | 1.0 | 2 | 1502.5 | same-strand | Thioredoxin domain |