Result : O25626
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | AE000511.1 |
| Organism | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) |
| Left | 1037309 |
| Right | 1037590 |
| Strand | + |
| Nucleotide Sequence | ATGCAAATTGATGACGCATTATTGCAACGCTTGGAAAAATTGAGCATGCTAGAGATTAAAGATGAGCATAAAGAGAGCGTTAAAGGTCATTTAGCGGAGGTTTTAGGCTTTGTAGAAAACATTTTCGCTTTAGAAACTAGCGCGCTAAAAACAGATATAGAGCTATGCACCCCCTTAAGAGAAGACGAGCCTAAAAGCCAACCTAACACCGCCAAAGAGATTTTGAGCCAAAACAAACACAGCCAGGATCATTACTTCGTTGTGCCCAAGATCATTGAATAG |
| Sequence | MQIDDALLQRLEKLSMLEIKDEHKESVKGHLAEVLGFVENIFALETSALKTDIELCTPLREDEPKSQPNTAKEILSQNKHSQDHYFVVPKIIE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity). {ECO:0000250}. |
| Pubmed ID | 9252185 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | O25626 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 989663 | 989944 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 917354 | 917632 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 3 | 1433497 | 1433778 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 4 | 1723732 | 1724022 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 5 | 108067 | 108345 | + | NZ_LN907858.1 | Helicobacter typhlonius |
| 6 | 752222 | 752512 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
++ More..