Result : O25237
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HP_0495 |
| NCBI Accession ID | AE000511.1 |
| Organism | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) |
| Left | 521862 |
| Right | 522122 |
| Strand | - |
| Nucleotide Sequence | ATGCCATCTGATTCAAAAAAACCCACCATTATTTACCCTTGCCTTTGGGATTATAGGGTGATTATGACCACTAAAGATACAAGCACGTTAAAAGAGCTTTTAGAAACCTACCAACGCCCCTTTAAATTGGAATTTAAAAACACTTCTAAAAACGCTAAGTTTTATAGCTTCAATGTTTCTATGGAAGTTTCAAACGAATCAGAACGGAACGAGATTTTTCAAAAAATTTCACAATTAGACAAAGTGGTTCAAACGCTTTAA |
| Sequence | MPSDSKKPTIIYPCLWDYRVIMTTKDTSTLKELLETYQRPFKLEFKNTSKNAKFYSFNVSMEVSNESERNEIFQKISQLDKVVQTL |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9252185 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O25237 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 480814 | 481074 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 706325 | 706585 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 3 | 316297 | 316551 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017379.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02254.20 | 1.0 | 3 | 3824 | same-strand | TrkA-N domain |
| 2 | PF02080.23 | 1.0 | 3 | 3824 | same-strand | TrkA-C domain |
| 3 | PF00830.21 | 1.0 | 3 | 3430 | same-strand | Ribosomal L28 family |
| 4 | PF05211.14 | 1.0 | 3 | 2490 | same-strand | Neuraminyllactose-binding hemagglutinin precursor (NLBH) |
| 5 | PF00953.23 | 1.0 | 3 | 1268 | opposite-strand | Glycosyl transferase family 4 |
| 6 | PF10555.11 | 1.0 | 3 | 1268 | opposite-strand | Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1 |
| 7 | PF03061.24 | 1.0 | 3 | -10 | same-strand | Thioesterase superfamily |
| 8 | PF13279.8 | 0.67 | 2 | -10.0 | same-strand | Thioesterase-like superfamily |
++ More..