Result : O24817
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YdzJ |
| NCBI Accession ID | AB007638.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 12399 |
| Right | 12557 |
| Strand | - |
| Nucleotide Sequence | GTGATCTCAAACCAGCAGCAAAAAGACTTGAAAAAAAGAGCTGCGTTCAAAAAGCTGAATGTTGCAATGAACTCATATGTTGAACTTCTGTTTTTGTCGGTACCTCTGATTCATATCTTTAAATGGCTCGGATCATTAGCCCTGCACCTCATCCATTAA |
| Sequence | MISNQQQKDLKKRAAFKKLNVAMNSYVELLFLSVPLIHIFKWLGSLALHLIH |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9455482 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O24817 |
| ORF Length (Amino Acid) | 52 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 680907 | 681065 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 660448 | 660606 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 817854 | 818012 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 643339 | 643488 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 1332157 | 1332315 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 666189 | 666347 | - | NZ_CP051464.1 | Bacillus mojavensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07885.18 | 0.67 | 4 | 5066.5 | same-strand | Ion channel |
| 2 | PF00083.26 | 0.67 | 4 | 3043.5 | opposite-strand | Sugar (and other) transporter |
| 3 | PF08240.14 | 1.0 | 6 | 1955.0 | same-strand | Alcohol dehydrogenase GroES-like domain |
| 4 | PF00107.28 | 1.0 | 6 | 1955.0 | same-strand | Zinc-binding dehydrogenase |
| 5 | PF16912.7 | 1.0 | 6 | 1955.0 | same-strand | Glucose dehydrogenase C-terminus |
| 6 | PF03330.20 | 1.0 | 6 | 1144.5 | opposite-strand | Lytic transglycolase |
| 7 | PF14169.8 | 1.0 | 6 | 187.0 | same-strand | Cold-inducible protein YdjO |
| 8 | PF12697.9 | 1.0 | 6 | 478.5 | same-strand | Alpha/beta hydrolase family |
| 9 | PF03096.16 | 0.67 | 4 | 480.5 | same-strand | Ndr family |
| 10 | PF13170.8 | 1.0 | 6 | 1307.5 | same-strand | Protein of unknown function (DUF4003) |
| 11 | PF07731.16 | 1.0 | 6 | 2397.0 | same-strand | Multicopper oxidase |
| 12 | PF00324.23 | 1.0 | 6 | 4086.0 | same-strand | Amino acid permease |
| 13 | PF13520.8 | 1.0 | 6 | 4086.0 | same-strand | Amino acid permease |
| 14 | PF03845.15 | 1.0 | 6 | 4086.0 | same-strand | Spore germination protein |
++ More..