Protein Information |
Information Type | Description |
---|---|
Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
NCBI Accession ID | U52367.1 |
Organism | Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) |
Left | 1360 |
Right | 1605 |
Strand | + |
Nucleotide Sequence | ATGAATATTGATTCTCATACTTTTTTACTAGGAATGCAATATCTAGGTGCAGGTCTAGCAGCAATTGGATGTATTGGTGGAGGTGTAGGTATAGGTACTGTTACAGGTAAAGCAGTTGAAGCAATTGGAAGACAACCAGAATCAGCTTCAAAAGTTATGCCTACAATGATAATGGGTTTAGCATTTGCTGAAGTTACATCATTATACGCTTTATTCGTTGCTATAATGTTATTATTTGTTAAATAA |
Sequence | MNIDSHTFLLGMQYLGAGLAAIGCIGGGVGIGTVTGKAVEAIGRQPESASKVMPTMIMGLAFAEVTSLYALFVAIMLLFVK |
Source of smORF | Swiss-Prot |
Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
Pubmed ID | 10902917 11466286 |
Domain | CDD:412393 |
Functional Category | Others |
Uniprot ID | O08310 |
ORF Length (Amino Acid) | 81 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3005790 | 3006035 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
2 | 3749867 | 3750079 | - | NC_014393.1 | Clostridium cellulovorans 743B |
3 | 2218898 | 2219122 | - | NC_008593.1 | Clostridium novyi NT |
4 | 205497 | 205766 | + | NC_018664.1 | Gottschalkia acidurici 9a |
5 | 93832 | 94080 | + | NZ_CP002082.1 | Spiroplasma mirum ATCC 29335 |
6 | 93838 | 94086 | + | NZ_CP011855.1 | Spiroplasma atrichopogonis |
7 | 120005 | 120253 | + | NZ_CP011856.1 | Spiroplasma eriocheiris |
8 | 2259036 | 2259248 | - | NZ_LR590481.1 | Hathewaya histolytica |
9 | 129470 | 129676 | + | NZ_CP013197.1 | Spiroplasma citri |
10 | 1341751 | 1341957 | - | NZ_CP010899.1 | Spiroplasma kunkelii CR2-3x |
11 | 843716 | 843922 | - | NZ_CP031088.1 | Spiroplasma phoeniceum P40 |
12 | 2438489 | 2438707 | - | NZ_CP027286.1 | Clostridium chauvoei |
13 | 186394 | 186633 | + | NZ_CP028842.1 | Clostridium botulinum |
14 | 185559 | 185798 | + | NZ_CP011663.1 | Clostridium sporogenes |
15 | 3831557 | 3831808 | - | NZ_CP013019.1 | Clostridium pasteurianum |
16 | 103667 | 103906 | + | NC_021280.1 | Spiroplasma chrysopicola DF-1 |
17 | 123202 | 123441 | + | NC_021284.1 | Spiroplasma syrphidicola EA-1 |
18 | 781507 | 781770 | - | NZ_CP024965.1 | Entomoplasma somnilux |
19 | 2496862 | 2497077 | - | NZ_HG917868.1 | Clostridium bornimense |
20 | 133276 | 133479 | + | NZ_CP024969.1 | Mesoplasma tabanidae |
21 | 135042 | 135293 | + | NC_006055.1 | Mesoplasma florum L1 |
22 | 137742 | 137993 | + | NZ_CP024411.1 | Mesoplasma entomophilum |
23 | 201792 | 202058 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
24 | 782112 | 782318 | - | NZ_CP024962.1 | Entomoplasma freundtii |
25 | 138175 | 138390 | - | NZ_CP024963.1 | Entomoplasma luminosum |
26 | 3006034 | 3006249 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
27 | 780536 | 780733 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
28 | 4820161 | 4820406 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
29 | 5667203 | 5667451 | + | NZ_CP020953.1 | Clostridium drakei |
30 | 4233981 | 4234229 | - | NZ_CP009933.1 | Clostridium scatologenes |
31 | 251405 | 251647 | + | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
32 | 467225 | 467437 | + | NC_013061.1 | Pedobacter heparinus DSM 2366 |
33 | 2503338 | 2503583 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
34 | 244081 | 244326 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
35 | 82863 | 83102 | + | NZ_LS991954.1 | Mycoplasma putrefaciens |
36 | 2456658 | 2456882 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
37 | 165776 | 166015 | + | NZ_CP014170.1 | Clostridium tyrobutyricum |
38 | 194144 | 194389 | + | NZ_CP032416.1 | Clostridium fermenticellae |
39 | 3664233 | 3664478 | - | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00006.27 | 0.64 | 25 | 1227 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
2 | PF02874.25 | 0.95 | 37 | 1153 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
3 | PF00213.20 | 0.82 | 32 | 547.0 | same-strand | ATP synthase delta (OSCP) subunit |
4 | PF00430.20 | 0.79 | 31 | 52.5 | same-strand | ATP synthase B/B' CF(0) |
5 | PF00119.22 | 0.64 | 25 | 48 | same-strand | ATP synthase A chain |