| Protein name |
Putative ribonuclease inhibitor YrdF |
| NCBI Accession ID |
Y11043.1 |
| Organism |
Bacillus subtilis (strain 168) |
| Left |
2696 |
| Right |
2971 |
| Strand |
+ |
| Nucleotide Sequence |
ATGAGAAAAATAATAATAGATGGAAGAGACTTTGAAAATATAGAAGTTTTACATGATGATTTAAAAGATAAACTAGACTTCCCAGACTACTATGGGAGAAATTTAGACGCTTTATGGGATTGCCTGACAGGGTGGGTGGATTTGCCGCTCACTTTAGTCTTGAAAAATTTTGAGTTCAGCAATACATTTTTAGGTTCATACGCTGACGATGTATTAGAAGTTATACAAGAGGCTCAAGAAGAACTAAAGGACGAATTTAAAATAATAATAGAGTAG |
| Sequence |
MRKIIIDGRDFENIEVLHDDLKDKLDFPDYYGRNLDALWDCLTGWVDLPLTLVLKNFEFSNTFLGSYADDVLEVIQEAQEELKDEFKIIIE |
| Source of smORF |
Swiss-Prot |
| Function |
The ORF matches to the profile of cl01048. Profile Description: N/A. Barstar_SaI14_like contains sequences that are similar to SaI14, an RNAase inhibitor, which are members of the Barstar family. Barstar is an intracellular inhibitor of barnase, an extracellular ribonuclease of Bacillus amyloliquefaciens. Barstar binds tightly to the barnase active site and sterically blocks it thus inhibiting its potentially lethal RNase activity inside the cell. The sequences in this subfamily are mostly uncharacterized, but believed to have a similar function and role. |
| Pubmed ID |
9287000
9308178
9384377
|
| Domain |
CDD:412713 |
| Functional Category |
Others |
| Uniprot ID |
O07938
|
| ORF Length (Amino Acid) |
91 |