Result : O07919
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Spore coat protein F-like protein YraG |
| NCBI Accession ID | X92868.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 15266 |
| Right | 15511 |
| Strand | - |
| Nucleotide Sequence | ATGGATCATCAAACATTGGCAGCTCATGAGGCTGTTGACTTACATGAAATCGTGAACTTTAAAACACTTTGTATAGCGAAATCAAAGTTAATGCAAGGGCTTGTGTTTGACCAAGAACTGAAGGACTTGATGGAAAAAGATGTACAGCAATCCATTCAAGACCTTACTGAATTACAAGCGGTTTATGAGCGTGCCTCATTTCAGGCCCCTGTCCCTCAAAGCCGCCCAACGCCAATCATCAATTGA |
| Sequence | MDHQTLAAHEAVDLHEIVNFKTLCIAKSKLMQGLVFDQELKDLMEKDVQQSIQDLTELQAVYERASFQAPVPQSRPTPIIN |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9141695 9308178 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O07919 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2752802 | 2753047 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2581187 | 2581432 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2558712 | 2558957 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2640030 | 2640275 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 3381824 | 3382069 | + | NZ_CP011937.1 | Bacillus velezensis |
| 6 | 571387 | 571632 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 7 | 197732 | 197977 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 8 | 473116 | 473322 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 9 | 5394599 | 5394844 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 10 | 2689524 | 2689769 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 11 | 1202368 | 1202613 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 12 | 4642951 | 4643196 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 13 | 1266284 | 1266529 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 14 | 1538493 | 1538738 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 15 | 2138596 | 2138847 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 16 | 881103 | 881366 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 17 | 210837 | 211034 | + | NZ_CP045296.1 | Paenibacillus cellulositrophicus |
| 18 | 1660733 | 1660978 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 19 | 2599217 | 2599483 | + | NZ_CP053989.1 | Niallia circulans |
| 20 | 3663236 | 3663478 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 21 | 519777 | 520022 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 22 | 5783329 | 5783571 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 23 | 1042177 | 1042401 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 24 | 955242 | 955466 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 25 | 849645 | 849869 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 26 | 1666102 | 1666308 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 27 | 26263 | 26496 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 28 | 2118635 | 2118868 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 29 | 3058474 | 3058680 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 30 | 1722849 | 1723058 | + | NZ_CP043998.1 | Clostridium diolis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07875.14 | 1.0 | 29 | 71 | same-strand | Coat F domain |
| 2 | PF08240.14 | 1.0 | 29 | 404 | same-strand | Alcohol dehydrogenase GroES-like domain |
| 3 | PF13823.8 | 1.0 | 29 | 404 | same-strand | Alcohol dehydrogenase GroES-associated |
++ More..