Result : A1W094
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP-dependent Clp protease adapter protein ClpS |
| NCBI Accession ID | CP000538.1 |
| Organism | Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) |
| Left | 1042745 |
| Right | 1043035 |
| Strand | + |
| Nucleotide Sequence | ATGCCAAAAACCCAGACTCTAGAGCAGACAAAACTTAGTGAACCAAAAATGTATAAAGTTATACTCTTAAATGATGATGTAACAACCATGGATTTTGTCATAGAAATTTTGATGAATATTTTTCATCAAAACCTTGAAAAAGCAAGTCAAACAATGTTAGAAATTCATCACAATGGTTCTGGAATTTGTGGCATTTACACTCAAGAAATAGCTCTTTCAAAACAAAAAAAAGTTATAGATGCGGCTAAACTTGCTAATTTTCCACTACAAGCAAAGGTAGAAGAAGAATGA |
| Sequence | MPKTQTLEQTKLSEPKMYKVILLNDDVTTMDFVIEILMNIFHQNLEKASQTMLEIHHNGSGICGIYTQEIALSKQKKVIDAAKLANFPLQAKVEEE |
| Source of smORF | Swiss-Prot |
| Function | Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation. {ECO:0000255|HAMAP-Rule:MF_00302}. |
| Pubmed ID | |
| Domain | CDD:412656 |
| Functional Category | Others |
| Uniprot ID | A1W094 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 87
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1040163 | 1040453 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 2 | 293389 | 293679 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 3 | 1029658 | 1029951 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 4 | 119332 | 119574 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 5 | 977966 | 978208 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 6 | 1054525 | 1054767 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 7 | 1290476 | 1290718 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 8 | 1108581 | 1108823 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 9 | 1017107 | 1017349 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 10 | 1076931 | 1077221 | - | NZ_CP020478.1 | Campylobacter helveticus |
| 11 | 871766 | 872056 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 12 | 994282 | 994575 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 13 | 1053098 | 1053340 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 14 | 583112 | 583405 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 15 | 821045 | 821341 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 16 | 1129730 | 1130020 | + | NZ_CP053842.1 | Campylobacter corcagiensis |
| 17 | 1554112 | 1554411 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 18 | 1732469 | 1732768 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 19 | 488654 | 488929 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 20 | 188871 | 189107 | + | NZ_CP019448.1 | Simonsiella muelleri ATCC 29453 |
| 21 | 894990 | 895226 | + | NZ_CP059564.1 | Alysiella filiformis |
| 22 | 1469821 | 1470054 | - | NZ_AP022847.1 | Nitrosophilus alvini |
| 23 | 2164501 | 2164758 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 24 | 461343 | 461576 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 25 | 1870919 | 1871152 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 26 | 1629722 | 1630021 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 27 | 1801615 | 1801914 | - | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 28 | 860472 | 860765 | - | NZ_CP021886.1 | Helicobacter apodemus |
| 29 | 675106 | 675339 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 30 | 758390 | 758689 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 31 | 2264131 | 2264430 | - | NZ_CP019070.1 | Poseidonibacter parvus |
| 32 | 375048 | 375347 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 33 | 2443294 | 2443593 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 34 | 1931704 | 1931946 | - | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 35 | 948341 | 948574 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 36 | 2172367 | 2172624 | - | NZ_CP031218.1 | Malaciobacter halophilus |
| 37 | 1456168 | 1456467 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 38 | 2238248 | 2238481 | - | NZ_CP042812.1 | Malaciobacter canalis |
| 39 | 3211233 | 3211469 | - | NZ_CP043575.1 | Comamonas koreensis |
| 40 | 2284947 | 2285204 | - | NZ_CP032101.1 | Malaciobacter marinus |
| 41 | 2048343 | 2048642 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 42 | 3547093 | 3547335 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 43 | 1427731 | 1427973 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 44 | 971692 | 971946 | + | NZ_CP007446.1 | Snodgrassella alvi wkB2 |
| 45 | 949011 | 949244 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 46 | 2376897 | 2377130 | - | NZ_CP041070.1 | Arcobacter anaerophilus |
| 47 | 2882472 | 2882735 | - | NZ_CP060414.1 | Neisseria musculi |
| 48 | 372354 | 372590 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 49 | 775354 | 775587 | + | NZ_AP018738.1 | Ferriphaselus amnicola |
| 50 | 1096167 | 1096400 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 51 | 3527907 | 3528149 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 52 | 801849 | 802082 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 53 | 539240 | 539512 | - | NZ_CP031253.1 | Neisseria lactamica |
| 54 | 2142826 | 2143125 | - | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 55 | 1266054 | 1266353 | - | NZ_CP016786.1 | Clostridium isatidis |
| 56 | 2222928 | 2223161 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 57 | 2485016 | 2485249 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 58 | 2289771 | 2290070 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 59 | 452431 | 452742 | - | NZ_CP072524.1 | Neisseria sicca |
| 60 | 452470 | 452772 | - | NZ_LS483369.1 | Neisseria cinerea |
| 61 | 1726863 | 1727135 | - | NZ_CP012028.1 | Neisseria gonorrhoeae |
| 62 | 483943 | 484215 | - | NZ_CP021520.1 | Neisseria meningitidis |
| 63 | 591619 | 591897 | + | NC_008783.1 | Bartonella bacilliformis KC583 |
| 64 | 2333601 | 2333834 | - | NZ_AP014936.1 | Sulfurifustis variabilis |
| 65 | 1788095 | 1788397 | - | NZ_CP031325.1 | Neisseria polysaccharea |
| 66 | 2149428 | 2149727 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 67 | 2458668 | 2458901 | - | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 68 | 2057946 | 2058179 | + | NZ_LR134533.1 | Neisseria weaveri |
| 69 | 2622866 | 2623108 | - | NZ_CP054626.1 | Cupriavidus gilardii |
| 70 | 3914202 | 3914435 | - | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 71 | 1497586 | 1497819 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 72 | 1714723 | 1714956 | + | NZ_LR134313.1 | Neisseria canis |
| 73 | 3715563 | 3715796 | - | NZ_CP062803.1 | Cupriavidus basilensis |
| 74 | 718425 | 718658 | + | NZ_LR134516.1 | Neisseria animaloris |
| 75 | 1946245 | 1946478 | + | NZ_CP059565.1 | Neisseria wadsworthii |
| 76 | 710904 | 711137 | + | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
| 77 | 298605 | 298847 | - | NZ_CP068286.1 | Ralstonia syzygii subsp. celebesensis |
| 78 | 951995 | 952228 | - | NZ_CP011257.1 | Ralstonia mannitolilytica |
| 79 | 1076574 | 1076816 | - | NZ_CP012943.1 | Ralstonia solanacearum |
| 80 | 2794316 | 2794549 | - | NZ_CP016022.1 | Ralstonia insidiosa |
| 81 | 1208905 | 1209138 | + | NZ_AP018685.1 | Vibrio rumoiensis |
| 82 | 1261929 | 1262225 | - | NC_015581.1 | Thiomicrospira cyclica ALM1 |
| 83 | 1251321 | 1251563 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 84 | 2087732 | 2087965 | + | NZ_CP022278.1 | Neisseria chenwenguii |
| 85 | 2000165 | 2000398 | + | NZ_CP008849.1 | Alteromonas australica |
| 86 | 3084639 | 3084872 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 87 | 1923724 | 1923966 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022826.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07724.16 | 1.0 | 87 | 2 | same-strand | AAA domain (Cdc48 subfamily) |
| 2 | PF17871.3 | 0.98 | 85 | 2 | same-strand | AAA lid domain |
| 3 | PF00004.31 | 1.0 | 87 | 2 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 4 | PF10431.11 | 1.0 | 87 | 2 | same-strand | C-terminal, D2-small domain, of ClpB protein |
| 5 | PF07728.16 | 1.0 | 87 | 2.0 | same-strand | AAA domain (dynein-related subfamily) |
| 6 | PF02861.22 | 0.77 | 67 | 3 | same-strand | Clp amino terminal domain, pathogenicity island component |
++ More..