Result : O07633
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YlaI |
| NCBI Accession ID | Z97025.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 7263 |
| Right | 7472 |
| Strand | - |
| Nucleotide Sequence | ATGATGAGGGTCAAATGTTCTATTTGCGATAAAATTGAAACAATTGATGATGATACCCTGATCGCGAAACGGCTTCGAAACCGCCCGATCCATACATATATGTGCCAGGAATGCCACGATCGGATTGCCAAAAAAACAGAGGAACGGCTGAAAACGGGAAAATTTACTTTTCACCCGGGACAGCAGAAAAAAGAAAAAGTCAAAAAATAA |
| Sequence | MMRVKCSICDKIETIDDDTLIAKRLRNRPIHTYMCQECHDRIAKKTEERLKTGKFTFHPGQQKKEKVKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23971. Profile Description: Uncharacterized protein conserved in bacteria (DUF2197). This domain, found in various hypothetical bacterial proteins, has no known function. |
| Pubmed ID | 9384377 |
| Domain | CDD:329205 |
| Functional Category | Others |
| Uniprot ID | O07633 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 82
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1548389 | 1548598 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1514855 | 1515064 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1455940 | 1456149 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 439107 | 439316 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 1521185 | 1521394 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 1552271 | 1552480 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1725184 | 1725393 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 1504803 | 1505012 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2456133 | 2456342 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 1667030 | 1667236 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 1652610 | 1652816 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 1675219 | 1675425 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 1096206 | 1096406 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 14 | 540985 | 541185 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 15 | 191730 | 191930 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 16 | 2884329 | 2884529 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 17 | 2270967 | 2271167 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 18 | 1865434 | 1865637 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 19 | 1342969 | 1343169 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 20 | 2046927 | 2047130 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 21 | 923368 | 923568 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 22 | 2092460 | 2092663 | + | NZ_CP059540.1 | Planococcus maritimus |
| 23 | 2510902 | 2511105 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 24 | 2070116 | 2070319 | + | NZ_CP016538.2 | Planococcus maritimus |
| 25 | 2299750 | 2299953 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 26 | 2901937 | 2902137 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 27 | 1681148 | 1681348 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 28 | 2486265 | 2486468 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 29 | 2918378 | 2918581 | - | NZ_CP013661.2 | Planococcus kocurii |
| 30 | 2345122 | 2345319 | + | NZ_CP019401.1 | Planococcus faecalis |
| 31 | 493007 | 493192 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 32 | 2195300 | 2195503 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 33 | 2209402 | 2209605 | + | NZ_CP016540.2 | Planococcus versutus |
| 34 | 3267106 | 3267306 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 35 | 1236948 | 1237148 | - | NZ_CP012024.1 | Bacillus smithii |
| 36 | 2691703 | 2691903 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 37 | 2645543 | 2645743 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 38 | 275848 | 276048 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 39 | 1311468 | 1311668 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 40 | 1560025 | 1560225 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 41 | 5090899 | 5091099 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 42 | 3878278 | 3878481 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 43 | 1926820 | 1927020 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 44 | 2041856 | 2042041 | - | NZ_CP053989.1 | Niallia circulans |
| 45 | 1258173 | 1258376 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 46 | 1325832 | 1326044 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 47 | 2205520 | 2205723 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 48 | 2152632 | 2152835 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 49 | 3399891 | 3400094 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 50 | 2860557 | 2860763 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 51 | 2537282 | 2537485 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 52 | 1625437 | 1625622 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 53 | 906513 | 906716 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 54 | 3763230 | 3763433 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 55 | 1706569 | 1706769 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 56 | 1438762 | 1438965 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 57 | 1827369 | 1827572 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 58 | 2469678 | 2469881 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 59 | 1538069 | 1538269 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 60 | 4104762 | 4104962 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 61 | 1583600 | 1583806 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 62 | 1955535 | 1955738 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 63 | 2924743 | 2924946 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 64 | 1075316 | 1075516 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 65 | 2085576 | 2085779 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 66 | 1387784 | 1387984 | - | NZ_CP040336.1 | Bacillus luti |
| 67 | 3817332 | 3817532 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 68 | 3977130 | 3977330 | + | NC_011725.1 | Bacillus cereus B4264 |
| 69 | 1374181 | 1374381 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 70 | 3388987 | 3389190 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 71 | 3842735 | 3842935 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 72 | 1533775 | 1533978 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 73 | 3984020 | 3984220 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 74 | 2738215 | 2738415 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 75 | 1899420 | 1899623 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 76 | 2739497 | 2739700 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 77 | 1466586 | 1466789 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 78 | 2652568 | 2652771 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 79 | 2783956 | 2784156 | + | NZ_LS483476.1 | Lederbergia lentus |
| 80 | 1684128 | 1684331 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 81 | 4026528 | 4026731 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 82 | 1166898 | 1167101 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 83 | 1301989 | 1302180 | - | NZ_CP019699.1 | Novibacillus thermophilus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006510.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17259.4 | 0.84 | 69 | 2753.0 | same-strand | Family of unknown function (DUF5325) |
| 2 | PF00009.29 | 0.82 | 67 | 796.0 | opposite-strand | Elongation factor Tu GTP binding domain |
| 3 | PF00679.26 | 0.82 | 67 | 796.0 | opposite-strand | Elongation factor G C-terminus |
| 4 | PF03144.27 | 0.82 | 67 | 796.0 | opposite-strand | Elongation factor Tu domain 2 |
| 5 | PF01926.25 | 0.82 | 67 | 796.0 | opposite-strand | 50S ribosome-binding GTPase |
| 6 | PF14036.8 | 0.93 | 76 | 350 | opposite-strand | YlaH-like protein |
| 7 | PF07408.13 | 0.93 | 76 | 2870 | opposite-strand | Protein of unknown function (DUF1507) |
| 8 | PF00459.27 | 0.7 | 57 | 2983.5 | opposite-strand | Inositol monophosphatase family |
++ More..