Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YlaF |
NCBI Accession ID | Z97025.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 4694 |
Right | 4882 |
Strand | - |
Nucleotide Sequence | ATGAAAAAAATGAATTGGCTTTTACTATTATTTGCATTTGCAGCGGTTTTCAGCATTATGCTGATCGGCGTCTTTATCGCTGAAAAAAGCCCTGCAGGCATTATCGCCAGCATTGTACTTGTTTGCGCTGTCATGGGCGGCGGATTTACATTAAAAAAGAAAATGCGCGAACAAGGCTTGCTTGATTAA |
Sequence | MKKMNWLLLLFAFAAVFSIMLIGVFIAEKSPAGIIASIVLVCAVMGGGFTLKKKMREQGLLD |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam17259. Profile Description: Family of unknown function (DUF5325). This is a family of unknown function mainly found in Bacilli. Family members of this family are predicted to have trans-membrane domains. |
Pubmed ID | 9384377 |
Domain | CDD:407373 |
Functional Category | Others |
Uniprot ID | O07630 |
ORF Length (Amino Acid) | 62 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1545820 | 1546008 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1512284 | 1512472 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 1549703 | 1549891 | - | NZ_CP051464.1 | Bacillus mojavensis |
4 | 441698 | 441886 | + | NZ_CP029364.1 | Bacillus halotolerans |
5 | 1518616 | 1518804 | - | NZ_CP013984.1 | Bacillus inaquosorum |
6 | 1451095 | 1451283 | - | NZ_CP048852.1 | Bacillus tequilensis |
7 | 1722615 | 1722803 | - | NZ_CP033052.1 | Bacillus vallismortis |
8 | 2458713 | 2458901 | + | NZ_CP011937.1 | Bacillus velezensis |
9 | 1502246 | 1502434 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 1662219 | 1662407 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
11 | 1670418 | 1670606 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
12 | 1647807 | 1647995 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
13 | 1339891 | 1340076 | - | NZ_CP024035.1 | Priestia aryabhattai |
14 | 1078559 | 1078741 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
15 | 4101535 | 4101717 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
16 | 1308618 | 1308803 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
17 | 1678352 | 1678537 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
18 | 1425044 | 1425205 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
19 | 1622048 | 1622233 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
20 | 2273904 | 2274077 | + | NZ_CP014342.1 | Geobacillus subterraneus |
21 | 1923887 | 1924072 | - | NZ_CP042593.1 | Bacillus dafuensis |
22 | 538116 | 538286 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
23 | 1234312 | 1234497 | - | NZ_CP012024.1 | Bacillus smithii |
24 | 489798 | 489983 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
25 | 91459 | 91638 | + | NZ_CP043404.1 | Bacillus safensis |
26 | 1442115 | 1442294 | - | NZ_CP011150.1 | Bacillus altitudinis |
27 | 279942 | 280127 | + | NZ_CP022983.1 | Cytobacillus kochii |
28 | 257211 | 257390 | + | NZ_CP017786.1 | Bacillus xiamenensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00009.29 | 1.0 | 28 | 118.0 | opposite-strand | Elongation factor Tu GTP binding domain |
2 | PF00679.26 | 1.0 | 28 | 118.0 | opposite-strand | Elongation factor G C-terminus |
3 | PF03144.27 | 1.0 | 28 | 118.0 | opposite-strand | Elongation factor Tu domain 2 |
4 | PF01926.25 | 1.0 | 28 | 118.0 | opposite-strand | 50S ribosome-binding GTPase |
5 | PF14036.8 | 1.0 | 28 | 2008.0 | opposite-strand | YlaH-like protein |
6 | PF09963.11 | 0.89 | 25 | 2665 | same-strand | Uncharacterized protein conserved in bacteria (DUF2197) |