Result : O07628
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Anti-sigma-YlaC factor YlaD |
| NCBI Accession ID | Z97025.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3477 |
| Right | 3770 |
| Strand | + |
| Nucleotide Sequence | ATGACCTGCTTTCTAGTAAGAGACCTGCTTCCTCTGTATCTTGAAGGTGATTGTAAAAGAGAAACGGAACACGTTATAGAAGAGCATTTAAAAATGTGCAGCAGCTGCAGAGACATGTATGACACGATGGCTGAGCCATTTGAATTGGAAAGCGAACAGGCCGTTGAGGAGGCTTATCTGCCGGAAGAAGAACTGCGTTTTAAACAGAGGTACTATGGATTACTGATCATGAAAGCTGCCTGCTGGTTTGGAGCGGCGGTTGCCATGATGCTGATCATCAAACTGCTGATATAA |
| Sequence | MTCFLVRDLLPLYLEGDCKRETEHVIEEHLKMCSSCRDMYDTMAEPFELESEQAVEEAYLPEEELRFKQRYYGLLIMKAACWFGAAVAMMLIIKLLI |
| Source of smORF | Swiss-Prot |
| Function | Anti-sigma factor for YlaC. {ECO:0000269|Pubmed:16728958}. |
| Pubmed ID | 9384377 16728958 |
| Domain | CDD:404386 |
| Functional Category | Metal-binding |
| Uniprot ID | O07628 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1544603 | 1544896 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1517398 | 1517691 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1511066 | 1511359 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1449874 | 1450167 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 1721396 | 1721689 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 1548487 | 1548780 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 442809 | 443102 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1500981 | 1501274 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2459869 | 2460162 | - | NZ_CP011937.1 | Bacillus velezensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04072.16 | 0.67 | 6 | 4921.0 | opposite-strand | Leucine carboxyl methyltransferase |
| 2 | PF01447.20 | 1.0 | 9 | 2998 | opposite-strand | Thermolysin metallopeptidase, catalytic domain |
| 3 | PF02868.17 | 1.0 | 9 | 2998 | opposite-strand | Thermolysin metallopeptidase, alpha-helical domain |
| 4 | PF07504.15 | 1.0 | 9 | 2998 | opposite-strand | Fungalysin/Thermolysin Propeptide Motif |
| 5 | PF03413.21 | 1.0 | 9 | 2998 | opposite-strand | Peptidase propeptide and YPEB domain |
| 6 | PF04542.16 | 0.78 | 7 | -3 | same-strand | Sigma-70 region 2 |
| 7 | PF08281.14 | 0.78 | 7 | -3 | same-strand | Sigma-70, region 4 |
| 8 | PF04545.18 | 0.78 | 7 | -3 | same-strand | Sigma-70, region 4 |
| 9 | PF17259.4 | 1.0 | 9 | 925 | opposite-strand | Family of unknown function (DUF5325) |
| 10 | PF00009.29 | 1.0 | 9 | 1226 | same-strand | Elongation factor Tu GTP binding domain |
| 11 | PF00679.26 | 1.0 | 9 | 1226 | same-strand | Elongation factor G C-terminus |
| 12 | PF03144.27 | 1.0 | 9 | 1226 | same-strand | Elongation factor Tu domain 2 |
| 13 | PF01926.25 | 1.0 | 9 | 1226 | same-strand | 50S ribosome-binding GTPase |
| 14 | PF14036.8 | 1.0 | 9 | 3121 | same-strand | YlaH-like protein |
| 15 | PF09963.11 | 0.89 | 8 | 3494.5 | opposite-strand | Uncharacterized protein conserved in bacteria (DUF2197) |
++ More..