Result : O07626
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YlaB |
| NCBI Accession ID | Z97025.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2690 |
| Right | 2959 |
| Strand | + |
| Nucleotide Sequence | ATGAATCATAAAGAAAAAGAGTCTGTTTTTGTAGACTTATACGACCTGTATAAAGAAGGAGAGCTAGAGGATGAATCAATGGAATGGATGAAACAGCATGAATCCCTATTTCAAAAGAATGCGGAAGACTTAAAGAGTAAAACTTGTTTAAAGAGAAGTCCCGGTGCTGAAGAAGAAAGCCAAATCAGATATATGAAAGTATACCTGTCTTCCATGTATATCTGTTTCATTTTATTGGCCATTTGGATGACGGTGTGGTTTTATTTTTAA |
| Sequence | MNHKEKESVFVDLYDLYKEGELEDESMEWMKQHESLFQKNAEDLKSKTCLKRSPGAEEESQIRYMKVYLSSMYICFILLAIWMTVWFYF |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O07626 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1543816 | 1544085 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1516611 | 1516880 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1510279 | 1510548 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1449087 | 1449356 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 1720609 | 1720878 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 1547709 | 1547969 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1500193 | 1500462 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00459.27 | 0.71 | 5 | 5578 | same-strand | Inositol monophosphatase family |
| 2 | PF04072.16 | 0.71 | 5 | 4136 | opposite-strand | Leucine carboxyl methyltransferase |
| 3 | PF01447.20 | 1.0 | 7 | 2215 | opposite-strand | Thermolysin metallopeptidase, catalytic domain |
| 4 | PF02868.17 | 1.0 | 7 | 2215 | opposite-strand | Thermolysin metallopeptidase, alpha-helical domain |
| 5 | PF07504.15 | 1.0 | 7 | 2215 | opposite-strand | Fungalysin/Thermolysin Propeptide Motif |
| 6 | PF03413.21 | 1.0 | 7 | 2215 | opposite-strand | Peptidase propeptide and YPEB domain |
| 7 | PF04542.16 | 1.0 | 7 | 0 | same-strand | Sigma-70 region 2 |
| 8 | PF08281.14 | 1.0 | 7 | 0 | same-strand | Sigma-70, region 4 |
| 9 | PF04545.18 | 1.0 | 7 | 0 | same-strand | Sigma-70, region 4 |
| 10 | PF13490.8 | 1.0 | 7 | 518 | same-strand | Putative zinc-finger |
| 11 | PF17259.4 | 1.0 | 7 | 1736 | opposite-strand | Family of unknown function (DUF5325) |
| 12 | PF00009.29 | 1.0 | 7 | 2037 | same-strand | Elongation factor Tu GTP binding domain |
| 13 | PF00679.26 | 1.0 | 7 | 2037 | same-strand | Elongation factor G C-terminus |
| 14 | PF03144.27 | 1.0 | 7 | 2037 | same-strand | Elongation factor Tu domain 2 |
| 15 | PF01926.25 | 1.0 | 7 | 2037 | same-strand | 50S ribosome-binding GTPase |
++ More..