Protein Information |
Information Type | Description |
---|---|
Protein name | Subtilosin-A (Antilisterial bacteriocin subtilosin) |
NCBI Accession ID | AJ430547.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 367 |
Right | 498 |
Strand | + |
Nucleotide Sequence | ATGAAAAAAGCTGTCATTGTGGAAAACAAAGGTTGTGCAACATGCTCGATCGGAGCCGCTTGTCTAGTGGACGGTCCTATCCCTGATTTTGAAATTGCCGGTGCTACAGGTCTATTCGGTCTATGGGGATAA |
Sequence | MKKAVIVENKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG |
Source of smORF | Swiss-Prot |
Function | Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium (Pubmed:10572140, Pubmed:19633086, Pubmed:3936839). A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood (Pubmed:19633086). {ECO:0000269|Pubmed:10572140, ECO:0000269|Pubmed:19633086, ECO:0000269|Pubmed:3936839}. |
Pubmed ID | 9353933 9384377 3936839 10572140 10809710 19633086 22366720 12696888 |
Domain | CDD:371520 |
Functional Category | Antimicrobial |
Uniprot ID | O07623 |
ORF Length (Amino Acid) | 43 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3836058 | 3836189 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2402436 | 2402567 | - | NZ_CP029364.1 | Bacillus halotolerans |
3 | 3725709 | 3725840 | + | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 3663629 | 3663760 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
5 | 3650722 | 3650853 | + | NZ_CP051464.1 | Bacillus mojavensis |
6 | 3667131 | 3667262 | + | NZ_CP048852.1 | Bacillus tequilensis |
7 | 135365 | 135496 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
8 | 1023644 | 1023775 | + | NZ_CP012024.1 | Bacillus smithii |
9 | 908030 | 908161 | + | NZ_CP027770.1 | Staphylococcus felis |
10 | 319733 | 319846 | - | NZ_CP046314.1 | Gemella morbillorum |
11 | 315570 | 315683 | - | NZ_CP046314.1 | Gemella morbillorum |
12 | 1048093 | 1048206 | - | NZ_CP009761.1 | Parvimonas micra |
13 | 1043929 | 1044042 | - | NZ_CP009761.1 | Parvimonas micra |
14 | 1385724 | 1385852 | - | NZ_CP007264.1 | Thermococcus nautili |
15 | 20053 | 20181 | + | NZ_LT900021.1 | Thermococcus henrietii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00325.22 | 0.62 | 8 | 3829.5 | opposite-strand | Bacterial regulatory proteins, crp family |
2 | PF13545.8 | 0.62 | 8 | 3829.5 | opposite-strand | Crp-like helix-turn-helix domain |
3 | PF04055.23 | 0.92 | 12 | 134.5 | same-strand | Radical SAM superfamily |
4 | PF13186.8 | 0.69 | 9 | 135 | same-strand | Iron-sulfur cluster-binding domain |
5 | PF00005.29 | 1.0 | 13 | 1652.0 | same-strand | ABC transporter |