Result : O07606
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YhfH |
| NCBI Accession ID | Y14083.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 17951 |
| Right | 18091 |
| Strand | - |
| Nucleotide Sequence | TTGGTTATGCTGGGGAAAATCACAGAATTTTTTAGAAACCTGCCTTCGAAAAAGTGTGCGGAATGCGGAAAAAAGATAGAAGAGCAGCATGAGTGTTATGGTAATATCTGCAATGACTGTATAAAAGTAAACGATTTGTAA |
| Sequence | MVMLGKITEFFRNLPSKKCAECGKKIEEQHECYGNICNDCIKVNDL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14149. Profile Description: YhfH-like protein. The YhfH-like protein family includes the B. subtilis YhfH protein, which is functionally uncharacterized. Its expression is repressed by the Spx paralogue MgsR, which regulates genes involved in stress response. This family of proteins is found in bacteria. Proteins in this family are typically between 42 and 53 amino acids in length. |
| Pubmed ID | 9579061 9384377 |
| Domain | CDD:404942 |
| Functional Category | Others |
| Uniprot ID | O07606 |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 68
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1082423 | 1082563 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 2 | 1098120 | 1098260 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 1030388 | 1030528 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 1070802 | 1070942 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 1278412 | 1278555 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 894269 | 894409 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1101999 | 1102139 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1175078 | 1175212 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 9 | 1101863 | 1101997 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 10 | 4040513 | 4040644 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 1192397 | 1192531 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 4229462 | 4229593 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 130208 | 130351 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 14 | 665918 | 666049 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 15 | 1375739 | 1375876 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 16 | 3231685 | 3231819 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 488454 | 488591 | + | NZ_CP043404.1 | Bacillus safensis |
| 18 | 1006144 | 1006281 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 19 | 622764 | 622901 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 20 | 990610 | 990747 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 21 | 523609 | 523743 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 22 | 1641147 | 1641281 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 23 | 3351169 | 3351306 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 24 | 3201085 | 3201210 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 25 | 3318935 | 3319072 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 26 | 1601128 | 1601265 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 27 | 684509 | 684646 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 28 | 3791505 | 3791639 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 29 | 177769 | 177903 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 30 | 1920420 | 1920545 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 31 | 2627132 | 2627269 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 32 | 2626983 | 2627102 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 33 | 2626803 | 2626940 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 34 | 1023153 | 1023293 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 35 | 2923566 | 2923706 | + | NZ_CP011937.1 | Bacillus velezensis |
| 36 | 1315069 | 1315206 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 37 | 2610913 | 2611050 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 38 | 841316 | 841450 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 39 | 1379964 | 1380098 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 40 | 2373001 | 2373123 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 41 | 1259308 | 1259436 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 42 | 3203855 | 3203980 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 43 | 591271 | 591402 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 44 | 908016 | 908141 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 45 | 26881 | 27009 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 46 | 512565 | 512684 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 47 | 3651046 | 3651171 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 48 | 3650842 | 3650967 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 49 | 3650640 | 3650765 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 50 | 1088615 | 1088740 | - | NZ_CP019401.1 | Planococcus faecalis |
| 51 | 680222 | 680347 | + | NZ_CP013661.2 | Planococcus kocurii |
| 52 | 1091020 | 1091145 | - | NZ_CP059540.1 | Planococcus maritimus |
| 53 | 1079798 | 1079923 | - | NZ_CP016538.2 | Planococcus maritimus |
| 54 | 823124 | 823249 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 55 | 1154292 | 1154417 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 56 | 1108356 | 1108481 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 57 | 944408 | 944521 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 58 | 1064369 | 1064497 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 59 | 4007731 | 4007859 | + | NZ_CP040336.1 | Bacillus luti |
| 60 | 3846204 | 3846329 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 61 | 1096954 | 1097082 | - | NC_011725.1 | Bacillus cereus B4264 |
| 62 | 1088883 | 1089011 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 63 | 1069102 | 1069230 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 64 | 1050671 | 1050796 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 65 | 853091 | 853216 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 66 | 1018033 | 1018158 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 67 | 901429 | 901554 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 68 | 3217159 | 3217296 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 69 | 2749381 | 2749506 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 70 | 1902977 | 1903102 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 71 | 3008462 | 3008587 | + | NZ_LS483476.1 | Lederbergia lentus |
| 72 | 1239320 | 1239454 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 73 | 2049409 | 2049534 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 74 | 2049235 | 2049360 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 75 | 2833232 | 2833357 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 76 | 2833060 | 2833185 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 77 | 1111807 | 1111935 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 78 | 3018345 | 3018470 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 79 | 1819577 | 1819711 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 80 | 2359228 | 2359365 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12706.9 | 0.69 | 47 | 157 | opposite-strand | Beta-lactamase superfamily domain |
| 2 | PF10437.11 | 0.81 | 55 | 899.0 | opposite-strand | Bacterial lipoate protein ligase C-terminus |
| 3 | PF03099.21 | 0.81 | 55 | 899.0 | opposite-strand | Biotin/lipoate A/B protein ligase family |
| 4 | PF00501.30 | 0.65 | 44 | 2157.5 | opposite-strand | AMP-binding enzyme |
| 5 | PF13193.8 | 0.65 | 44 | 2157.5 | opposite-strand | AMP-binding enzyme C-terminal domain |
++ More..