Result : O07580
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable anti-sigma-M factor YhdK |
| NCBI Accession ID | Y14082.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 14861 |
| Right | 15151 |
| Strand | - |
| Nucleotide Sequence | ATGGAACTGGTAAGAATTTTTAAAGAACACAATGTATTCGGCTGGATCTCTGTCGGGACAGCGGTTCTGTCCCTGCTGTTGCTGAATTTGGCCATTATCAGCAACGTCACGTTTTATTCCTATCAAATGCTTCCGTTCGCCATGGCTGCCGTTCCGTTCGGCGTTGTTGAACTCTTCATCAAGAGAGGGCGCACAGGTCCAGGCCTGCTCGGCGTCATCCTTAATCTCTTTGTGATTATTTGTGTGTATACCATTGTATCTGTAGATACGAATTTACAGTTTGGCTTTTAA |
| Sequence | MELVRIFKEHNVFGWISVGTAVLSLLLLNLAIISNVTFYSYQMLPFAMAAVPFGVVELFIKRGRTGPGLLGVILNLFVIICVYTIVSVDTNLQFGF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17453. Profile Description: Sigma-M inhibitor protein. This is a domain of unknown function found in Sigma M inhibitor proteins YhdK. In Bacillus subtilis, sigM (yhdM) gene, is required for growth and survival after salt stress. Expression of sigM is positively autoregulated and is controlled by growth phase and medium composition. SigM-dependent transcription is regulated by the products of both the yhdL and the yhdK genes, which are co-transcribed with the sigM gene. The small hydrophobic protein YhdK, appears to interact with the trans-membrane domain of YhdL, suggesting some specific role for YhdK in the anti-sigma function of YhdL. |
| Pubmed ID | 9579061 9384377 10216858 14993308 |
| Domain | CDD:340168 |
| Functional Category | Others |
| Uniprot ID | O07580 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1028233 | 1028523 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 998288 | 998578 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 959162 | 959452 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 1206117 | 1206407 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2992724 | 2993014 | + | NZ_CP011937.1 | Bacillus velezensis |
| 6 | 953854 | 954144 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 7 | 687465 | 687755 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 8 | 942596 | 942886 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 9 | 552077 | 552367 | + | NZ_CP043404.1 | Bacillus safensis |
| 10 | 1088602 | 1088892 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 966658 | 966948 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 12 | 1010303 | 1010593 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 13 | 1029429 | 1029719 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 14 | 1022112 | 1022402 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 15 | 1111913 | 1112203 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13561.8 | 0.6 | 9 | 5133 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 2 | PF00106.27 | 0.6 | 9 | 5133 | opposite-strand | short chain dehydrogenase |
| 3 | PF08659.12 | 0.6 | 9 | 5133 | opposite-strand | KR domain |
| 4 | PF13520.8 | 0.8 | 12 | 3486.0 | opposite-strand | Amino acid permease |
| 5 | PF00324.23 | 0.8 | 12 | 3486.0 | opposite-strand | Amino acid permease |
| 6 | PF13906.8 | 0.8 | 12 | 3486.0 | opposite-strand | C-terminus of AA permease |
| 7 | PF00155.23 | 0.67 | 10 | 572.0 | same-strand | Aminotransferase class I and II |
| 8 | PF00392.23 | 0.67 | 10 | 572.0 | same-strand | Bacterial regulatory proteins, gntR family |
| 9 | PF00583.27 | 0.67 | 10 | 32.0 | opposite-strand | Acetyltransferase (GNAT) family |
| 10 | PF13791.8 | 1.0 | 15 | -12 | same-strand | Sigma factor regulator C-terminal |
| 11 | PF13800.8 | 1.0 | 15 | -12 | same-strand | Sigma factor regulator N-terminal |
| 12 | PF04542.16 | 1.0 | 15 | 1054 | same-strand | Sigma-70 region 2 |
| 13 | PF08281.14 | 1.0 | 15 | 1054 | same-strand | Sigma-70, region 4 |
| 14 | PF04545.18 | 1.0 | 15 | 1054 | same-strand | Sigma-70, region 4 |
| 15 | PF01553.23 | 1.0 | 15 | 2871 | opposite-strand | Acyltransferase |
++ More..