Result : O07557
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YhjC |
| NCBI Accession ID | Y14081.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2895 |
| Right | 3095 |
| Strand | - |
| Nucleotide Sequence | ATGAAACTGATTCACGTTCTTGCCGCTTTACCCTTTATCGGAATCTTACTCGGCATCCCTTTTGCAAATAAGGTGACCCCCTATGTGTTCGGCATGCCGTTTATTCTTGCCTATATTGTGATGTGGGCTCTTTTGACCTCTGCGCTGATGGCGATTGTGTATGTCCTCGACAAGGAAAATAAAAAGGAGGAAGCAGAATGA |
| Sequence | MKLIHVLAALPFIGILLGIPFANKVTPYVFGMPFILAYIVMWALLTSALMAIVYVLDKENKKEEAE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam11755. Profile Description: Protein of unknown function (DUF3311). This is a family of short bacterial proteins of unknown function. |
| Pubmed ID | 9579061 9384377 |
| Domain | CDD:403070 |
| Functional Category | Others |
| Uniprot ID | O07557 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 44
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1093433 | 1093633 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 2 | 1120628 | 1120828 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 1052907 | 1053107 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 1105219 | 1105419 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 1124558 | 1124758 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 869673 | 869873 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1298097 | 1298297 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 1045005 | 1045205 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2901651 | 2901851 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 1088878 | 1089078 | - | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 11 | 2604279 | 2604491 | - | NZ_CP024942.1 | Paraburkholderia terricola |
| 12 | 1939814 | 1940026 | + | NC_007952.1 | Paraburkholderia xenovorans LB400 |
| 13 | 979789 | 979986 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 14 | 656578 | 656790 | + | NZ_CP022990.1 | Paraburkholderia aromaticivorans |
| 15 | 680321 | 680521 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 16 | 1429485 | 1429697 | - | NZ_CP031466.1 | Paraburkholderia caffeinilytica |
| 17 | 1464918 | 1465130 | + | NZ_CP066076.1 | Paraburkholderia ginsengisoli |
| 18 | 2092988 | 2093164 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 19 | 249608 | 249799 | + | NZ_CP015959.1 | Paraburkholderia caribensis |
| 20 | 1274510 | 1274701 | - | NZ_CP026112.1 | Paraburkholderia terrae |
| 21 | 2265532 | 2265708 | - | NZ_CP017562.1 | Paraburkholderia sprentiae WSM5005 |
| 22 | 452119 | 452310 | - | NZ_CP046910.1 | Paraburkholderia acidiphila |
| 23 | 2927601 | 2927801 | + | NZ_CP012024.1 | Bacillus smithii |
| 24 | 1494994 | 1495206 | + | NC_010676.1 | Paraburkholderia phytofirmans PsJN |
| 25 | 33267 | 33458 | + | NC_010623.1 | Paraburkholderia phymatum STM815 |
| 26 | 1938626 | 1938826 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 27 | 2279290 | 2279490 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 28 | 384408 | 384608 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 29 | 2145425 | 2145625 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 30 | 1105503 | 1105715 | - | NZ_CP024935.1 | Paraburkholderia graminis |
| 31 | 5407813 | 5408013 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 32 | 3277638 | 3277838 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 33 | 525527 | 525727 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 34 | 2160985 | 2161185 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 35 | 3304994 | 3305206 | - | NZ_CP011568.3 | Pandoraea thiooxydans |
| 36 | 3525499 | 3525696 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 37 | 3332675 | 3332878 | - | NZ_CP026363.1 | Brevibacillus agri |
| 38 | 1565801 | 1566004 | - | NZ_CP046914.1 | Paraburkholderia acidisoli |
| 39 | 728227 | 728424 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 40 | 725661 | 725858 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 41 | 4405742 | 4405939 | - | NZ_CP040336.1 | Bacillus luti |
| 42 | 716924 | 717121 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 43 | 3586376 | 3586582 | + | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 44 | 1530595 | 1530765 | + | NZ_CP016023.1 | Ralstonia insidiosa |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00474.19 | 0.89 | 39 | -3 | same-strand | Sodium:solute symporter family |
++ More..