Result : O07555
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YhjA |
| NCBI Accession ID | Y14081.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1117 |
| Right | 1386 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAAGCGGCGGCGGTTTTGCTGTCACTCGGTCTCGTTTTCGGTTTTTCATACGGAGCTGGCCATGTGGCGGAAGCCAAAACAAAGGTGAAGGTCTATAAGAACTGCAAGGAGCTAAACAAAGTATACAAAGGCGGAGTGGCCCGCACATCGAAGGTGAAAAACAAAGGCGGAAAAACGAAGTACAAGCCTTACGTTTCTAAGGCACTTTACGATGCCAATAAAAACAAAGACCGCGATAAAGATCTTATCGCCTGTGAACGGTAA |
| Sequence | MKKAAAVLLSLGLVFGFSYGAGHVAEAKTKVKVYKNCKELNKVYKGGVARTSKVKNKGGKTKYKPYVSKALYDANKNKDRDKDLIACER |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl05460. Profile Description: Excalibur calcium-binding domain. Extracellular Ca2+-dependent nuclease YokF from Bacillus subtilis and several other surface-exposed proteins from diverse bacteria are encoded in the genomes in two paralogous forms that differ by a ~45 amino acid fragment, which comprises a novel conserved domain. Sequence analysis of this domain revealed a conserved DxDxDGxxCE motif, which is strikingly similar to the Ca2+-binding loop of the calmodulin-like EF-hand domains, suggesting an evolutionary relationship between them. Functions of many of the other proteins in which the novel domain, named Excalibur (extracellular calcium-binding region), is found, as well as a structural model of its conserved motif are consistent with the notion that the Excalibur domain binds calcium. This domain is but one more example of the diversity of structural contexts surrounding the EF-hand-like calcium-binding loop in bacteria. This loop is thus more widespread than hitherto recognised and the evolution of EF-hand-like domains is probably more complex than previously appreciated. |
| Pubmed ID | 9579061 9384377 |
| Domain | CDD:414425 |
| Functional Category | Others |
| Uniprot ID | O07555 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 35
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1118850 | 1119119 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1051133 | 1051402 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 1103441 | 1103710 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 1091655 | 1091924 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 1296315 | 1296584 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2903708 | 2903977 | - | NZ_CP011937.1 | Bacillus velezensis |
| 7 | 1042879 | 1043148 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 8 | 1122781 | 1123050 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 9 | 872671 | 872940 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 10 | 3983925 | 3984194 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 4175816 | 4176085 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 4391435 | 4391704 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 566974 | 567243 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 14 | 3914525 | 3914794 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 15 | 3032887 | 3033156 | + | NZ_CP012024.1 | Bacillus smithii |
| 16 | 2525099 | 2525374 | - | NZ_CP016540.2 | Planococcus versutus |
| 17 | 2621142 | 2621417 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 18 | 2532769 | 2533044 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 19 | 1084243 | 1084509 | - | NZ_CP043404.1 | Bacillus safensis |
| 20 | 255182 | 255448 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 21 | 3737082 | 3737345 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 22 | 2870523 | 2870801 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 23 | 2285985 | 2286248 | - | NZ_CP053989.1 | Niallia circulans |
| 24 | 2662403 | 2662678 | - | NZ_CP019401.1 | Planococcus faecalis |
| 25 | 2025381 | 2025650 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 26 | 3234423 | 3234686 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 27 | 2598092 | 2598367 | + | NZ_CP013661.2 | Planococcus kocurii |
| 28 | 450690 | 450929 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 29 | 1159811 | 1160074 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 30 | 2843805 | 2844080 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 31 | 2026483 | 2026728 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 32 | 4510857 | 4511123 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 33 | 1319166 | 1319429 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 34 | 2599344 | 2599613 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 35 | 653670 | 653939 | + | NZ_CP011388.1 | Paenibacillus swuensis |
++ More..