Result : O07551
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YheJ |
| NCBI Accession ID | Y14080.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 16552 |
| Right | 16713 |
| Strand | - |
| Nucleotide Sequence | GTGTTTATCAAACAGTTTCATATTGGCGCGGCAAACCTTTTGTTCTGTTTTCGTGAACGGTTTTTTAGGTCGGACCGCGCGCTGAAAAGCGCTGTGCGTAACATATCGGTTAAAAAAGGCATGGAGCTGACGCTTCATGCCTTTTTTATATACAAAATCTAA |
| Sequence | MFIKQFHIGAANLLFCFRERFFRSDRALKSAVRNISVKKGMELTLHAFFIYKI |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9579061 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O07551 |
| ORF Length (Amino Acid) | 53 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1045037 | 1045198 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1029324 | 1029485 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1225117 | 1225302 | + | NZ_CP033052.1 | Bacillus vallismortis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02146.19 | 1.0 | 3 | 4200 | same-strand | Sir2 family |
| 2 | PF01522.23 | 1.0 | 3 | 3326 | opposite-strand | Polysaccharide deacetylase |
| 3 | PF01063.21 | 1.0 | 3 | 2192 | same-strand | Amino-transferase class IV |
| 4 | PF03553.16 | 1.0 | 3 | 788 | opposite-strand | Na+/H+ antiporter family |
| 5 | PF00582.28 | 1.0 | 3 | 160 | opposite-strand | Universal stress protein family |
| 6 | PF00664.25 | 1.0 | 3 | 987.5 | same-strand | ABC transporter transmembrane region |
| 7 | PF00005.29 | 1.0 | 3 | 987.5 | same-strand | ABC transporter |
| 8 | PF13191.8 | 1.0 | 3 | 1874 | same-strand | AAA ATPase domain |
| 9 | PF13460.8 | 1.0 | 3 | 3942 | opposite-strand | NAD(P)H-binding |
| 10 | PF00269.22 | 1.0 | 3 | 4830 | opposite-strand | Small, acid-soluble spore proteins, alpha/beta type |
| 11 | PF17277.4 | 1.0 | 3 | 5244 | opposite-strand | Family of unknown function (DUF5342) |
++ More..