Result : O07547
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YheF |
| NCBI Accession ID | Y14080.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 11824 |
| Right | 11949 |
| Strand | + |
| Nucleotide Sequence | GTGTCATTCATCACCATTGTGAATTGGGAGCTGGTTCAATTCGTAAGTGTATCCATGATTCATGAATATGTTTCCCATCGTTCTGTTTATTTGTACAGGTATTCTTTCCCGCGCTGTTCAAACTGA |
| Sequence | MSFITIVNWELVQFVSVSMIHEYVSHRSVYLYRYSFPRCSN |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9579061 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O07547 |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1049801 | 1049926 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1034085 | 1034210 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1229882 | 1230007 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 942654 | 942761 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 1022271 | 1022396 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 1053616 | 1053723 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 981942 | 982067 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 2971561 | 2971686 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 975185 | 975310 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 961102 | 961218 | - | NZ_CP011150.1 | Bacillus altitudinis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00582.28 | 1.0 | 10 | 4925.0 | same-strand | Universal stress protein family |
| 2 | PF00664.25 | 1.0 | 10 | 1753.0 | opposite-strand | ABC transporter transmembrane region |
| 3 | PF00005.29 | 1.0 | 10 | 800 | opposite-strand | ABC transporter |
| 4 | PF13191.8 | 1.0 | 10 | 704.5 | opposite-strand | AAA ATPase domain |
| 5 | PF13460.8 | 1.0 | 10 | 39.0 | same-strand | NAD(P)H-binding |
| 6 | PF00269.22 | 1.0 | 10 | 109.0 | same-strand | Small, acid-soluble spore proteins, alpha/beta type |
| 7 | PF17277.4 | 1.0 | 10 | 538.5 | same-strand | Family of unknown function (DUF5342) |
| 8 | PF14398.8 | 1.0 | 10 | 2178 | same-strand | YheC/D like ATP-grasp |
| 9 | PF04286.14 | 0.9 | 9 | 3600 | opposite-strand | Protein of unknown function (DUF445) |
++ More..