Result : O07546
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YheE |
| NCBI Accession ID | Y14080.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 11089 |
| Right | 11307 |
| Strand | + |
| Nucleotide Sequence | GTGGCCGTAATGATTTCTCATTTCAGCTGGAAACCTTTGTTCCCAAAAGAAAAGCTGCCCGGATGGAAAATTTCATTTTATTATAAAGGGACCCATTATGAAGGCATCTATCATAAGAGCGGTGAGATTGAATGGGGAGACTTGTTTCCCGCCCGCGCTGACGAGCCTGCTCTTACAAACGAGATACATGAACTGATGCTTTTTCATATTTATGACTAG |
| Sequence | MAVMISHFSWKPLFPKEKLPGWKISFYYKGTHYEGIYHKSGEIEWGDLFPARADEPALTNEIHELMLFHIYD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17277. Profile Description: Family of unknown function (DUF5342). This family of no known function is found in Bacilli. |
| Pubmed ID | 9579061 9384377 |
| Domain | CDD:407390 |
| Functional Category | Others |
| Uniprot ID | O07546 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1050443 | 1050661 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1023114 | 1023332 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1230527 | 1230745 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 982788 | 983006 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 1034729 | 1034947 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 941931 | 942113 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1054263 | 1054472 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1056966 | 1057184 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 9 | 1122689 | 1122898 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 10 | 1147506 | 1147724 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 2970809 | 2971024 | + | NZ_CP011937.1 | Bacillus velezensis |
| 12 | 975842 | 976057 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 13 | 664692 | 664901 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 963900 | 964109 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 530652 | 530861 | + | NZ_CP043404.1 | Bacillus safensis |
| 16 | 3326774 | 3326983 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 1593889 | 1594101 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 18 | 564284 | 564496 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 19 | 786987 | 787199 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 20 | 3258709 | 3258921 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 21 | 3898905 | 3899108 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 22 | 800011 | 800214 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.77 | 17 | 1358 | opposite-strand | ABC transporter |
| 2 | PF00269.22 | 0.82 | 18 | 574.5 | same-strand | Small, acid-soluble spore proteins, alpha/beta type |
| 3 | PF14398.8 | 0.86 | 19 | 1445.5 | same-strand | YheC/D like ATP-grasp |
| 4 | PF04286.14 | 0.91 | 20 | 2851.0 | opposite-strand | Protein of unknown function (DUF445) |
| 5 | PF06133.13 | 0.82 | 18 | 4085.0 | opposite-strand | Control of competence regulator ComK, YlbF/YmcA |
++ More..