Result : O07520
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sporulation protein YhaL |
| NCBI Accession ID | Y14078.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 41 |
| Right | 253 |
| Strand | - |
| Nucleotide Sequence | GTGTTATTTTTTCCGTGGTGGGTGTATCTTTGTATTGTAGGCATCATTTTCAGCGCATATAAACTTGTGGCGGCAGCCAAAGAGGAAGAAAAAGTAGACCAGGCTTTTATTGAAAAAGAAGGACAGATTTATATGGAGAGGATGGAAAAGGAGCGAGAACGCCGCAGTTCTCAGCAGCATGAAGAAGAAAATCAAAACCATTCCATCGCATAA |
| Sequence | MLFFPWWVYLCIVGIIFSAYKLVAAAKEEEKVDQAFIEKEGQIYMERMEKERERRSSQQHEEENQNHSIA |
| Source of smORF | Swiss-Prot |
| Function | Required for efficient sporulation. {ECO:0000269|Pubmed:14523133}. |
| Pubmed ID | 9384377 14523133 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O07520 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1070111 | 1070323 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1073961 | 1074173 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 3 | 922208 | 922420 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 1002460 | 1002672 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 1042796 | 1043008 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 1250410 | 1250622 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 1054407 | 1054619 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 8 | 1075156 | 1075389 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 9 | 1165699 | 1165932 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 10 | 1143857 | 1144084 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 996710 | 996937 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 12 | 2949931 | 2950158 | - | NZ_CP011937.1 | Bacillus velezensis |
| 13 | 646966 | 647196 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 981429 | 981659 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 513091 | 513321 | - | NZ_CP043404.1 | Bacillus safensis |
| 16 | 968011 | 968193 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 17 | 1615744 | 1615932 | + | NZ_CP042593.1 | Bacillus dafuensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.82 | 14 | 6632.0 | same-strand | ABC transporter |
| 2 | PF13732.8 | 0.82 | 14 | 6632.0 | same-strand | Domain of unknown function (DUF4162) |
| 3 | PF12698.9 | 0.82 | 14 | 5379.5 | same-strand | ABC-2 family transporter protein |
| 4 | PF00149.30 | 0.94 | 16 | 4041.0 | same-strand | Calcineurin-like phosphoesterase |
| 5 | PF12850.9 | 0.94 | 16 | 4041.0 | same-strand | Calcineurin-like phosphoesterase superfamily domain |
| 6 | PF13514.8 | 0.94 | 16 | 1138.0 | same-strand | AAA domain |
| 7 | PF01966.24 | 1.0 | 17 | 117 | same-strand | HD domain |
| 8 | PF01336.27 | 0.82 | 14 | 125.0 | same-strand | OB-fold nucleic acid binding domain |
| 9 | PF13616.8 | 0.94 | 16 | 43.5 | opposite-strand | PPIC-type PPIASE domain |
| 10 | PF00639.23 | 0.94 | 16 | 43.5 | opposite-strand | PPIC-type PPIASE domain |
| 11 | PF13145.8 | 0.94 | 16 | 43.5 | opposite-strand | PPIC-type PPIASE domain |
| 12 | PF11667.10 | 0.94 | 16 | 1729.0 | opposite-strand | Putative zincin peptidase |
| 13 | PF08963.12 | 1.0 | 17 | 2458 | same-strand | Protein of unknown function (DUF1878) |
| 14 | PF01047.24 | 0.94 | 16 | 2788.0 | opposite-strand | MarR family |
| 15 | PF13463.8 | 0.94 | 16 | 2788.0 | opposite-strand | Winged helix DNA-binding domain |
++ More..