Result : O07227
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VapB2 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 363826 |
| Right | 364047 |
| Strand | + |
| Nucleotide Sequence | ATGAGTGATGTACTGATTCGGGACATCCCCGACGACGTGTTAGCAAGCCTTGACGCGATCGCGGCACGCTTGGGCTTGTCGCGGACCGAATACATCCGTCGGCGTTTAGCCCAGGATGCGCAGACGGCTCGCGTCACCGTGACAGCCGCGGATCTTCGACGCCTCAGGGGTGCGGTTGCCGGTCTGGGCGATCCCGAGCTTATGCGTCAGGCGTGGAGGTGA |
| Sequence | MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVAGLGDPELMRQAWR |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC2. The C-terminal helix of the antitoxin may obstruct the toxin's RNA-binding groove, blocking access to the active sites. Additionally, the C-terminal arginine of the antitoxin may remove Mg(2+) ions from the toxin active sites. {ECO:0000269|Pubmed:20011113, ECO:0000269|Pubmed:23011806, ECO:0000305|Pubmed:15718296}. |
| Pubmed ID | 9634230 15718296 20011113 21969609 23011806 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | O07227 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 363826 | 364047 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 528059 | 528283 | - | NZ_AP022605.1 | Mycobacterium doricum |
| 3 | 3465255 | 3465476 | + | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 4 | 167052 | 167273 | - | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 5 | 3858040 | 3858261 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 6 | 1209191 | 1209412 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 7 | 6683632 | 6683853 | + | NC_013729.1 | Kribbella flavida DSM 17836 |
| 8 | 3444160 | 3444381 | + | NZ_CP043661.1 | Kribbella qitaiheensis |
| 9 | 4092926 | 4093147 | + | NZ_CP033972.1 | Gordonia insulae |
| 10 | 3012930 | 3013151 | - | NZ_CP038213.1 | Ornithinimicrobium flavum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.9 | 9 | -3 | same-strand | PIN domain |
++ More..