Result : O06930
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Biotin carrier protein MADF (EC 4.1.1.-) |
| NCBI Accession ID | U87980.1 |
| Organism | Malonomonas rubra |
| Left | 9415 |
| Right | 9624 |
| Strand | + |
| Nucleotide Sequence | ATGGAAATTAAATCAAAAATGCCAGGATCTATCATTGAAGTAAAAGTTAGTGTTGGGGATAACCTTGAAGCAGGATCTCTTATTCTCATTATGGAAGCATTAAAAATGAAGCAAGAAATCAGGTCGCAAGAAGGTGGTGTAGTAAAAGAGCTTAAAGTTAATACGGGTGACAGGGTTAGTCCGGGTCAAGTTTTAGCCATAATTGAATGA |
| Sequence | MEIKSKMPGSIIEVKVSVGDNLEAGSLILIMEALKMKQEIRSQEGGVVKELKVNTGDRVSPGQVLAIIE |
| Source of smORF | Swiss-Prot |
| Function | Biotin-carrier subunit of the biotin-dependent malonate decarboxylase multienzyme complex (EC 7.2.4.4). The carboxyl group of the carboxylated biotin carrier is released by the membrane-bound carboxybiotin decarboxylase MADB. |
| Pubmed ID | 9128730 |
| Domain | CDD:416260 |
| Functional Category | Others |
| Uniprot ID | O06930 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 559372 | 559560 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 2 | 510578 | 510787 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 3 | 510820 | 511029 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 4 | 3679310 | 3679516 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 5 | 2226396 | 2226614 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 685613 | 685789 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 7 | 1892238 | 1892414 | + | NC_021169.1 | Archaeoglobus sulfaticallidus PM70-1 |
| 8 | 1857355 | 1857540 | + | NZ_CP038436.1 | Nocardioides seonyuensis |
| 9 | 1101637 | 1101810 | + | NZ_CP013189.1 | Pseudohongiella spirulinae |
| 10 | 1590582 | 1590773 | + | NC_013849.1 | Ferroglobus placidus DSM 10642 |
| 11 | 1612770 | 1612952 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
++ More..