Result : O06779
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable antitoxin MazE2 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 754980 |
| Right | 755225 |
| Strand | - |
| Nucleotide Sequence | ATGCTCAGCTTCCGCGCCGACGACCACGACGTCGACCTGGCCGACGCGTGGGCGCGTCGCCTACACATCGGCCGCTCCGAGCTGCTGCGCGATGCGCTGCGACGTCACTTGGCCGCGCTGGCCGCGGACCAGGATGTCCAGGCCTACACCGAGCGACCGTTGACGGACGACGAGAACGCACTGGCTGAGATCGCCGACTGGGGGCCGGCGGAGGACTGGGCCGACTGGGCCGATGCGGCGCGGTGA |
| Sequence | MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENALAEIADWGPAEDWADWADAAR |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. {ECO:0000305}. |
| Pubmed ID | 9634230 16611633 |
| Domain | CDD:425357 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | O06779 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 754980 | 755225 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 765008 | 765253 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 4040781 | 4041026 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 4 | 686245 | 686490 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 5 | 1186364 | 1186609 | - | NZ_AP022581.1 | Mycobacterium lacus |
++ More..