Result : O06775
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin VapB8 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 758532 |
| Right | 758804 |
| Strand | + |
| Nucleotide Sequence | ATGGAAAAGTCACGGTGCCACGCTGTCGCACATGGAGGTGGGTGTGCGGGATCTGCGAAATCGCACAAGTCAGGTGGTCGATGCGGTCAAGGCCGGGGTGCCGGTGACTCTCACGGTACACGGGGAGCCGGTCGCCGATATCGTGCCGCATCGGCGCCGCATCCGCTGGCTGTCGGGGCGCATCTGCGCGATGAGCTCGCCAAGCGCTCGGCCGACCCGCGCCTCACCGATGAACTCAACGACTTGGCCGGTCATACCCTCGACGACCTGTGA |
| Sequence | MEKSRCHAVAHGGGCAGSAKSHKSGGRCGQGRGAGDSHGTRGAGRRYRAASAPHPLAVGAHLRDELAKRSADPRLTDELNDLAGHTLDDL |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC8. {ECO:0000305|Pubmed:15718296}. |
| Pubmed ID | 9634230 15718296 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | O06775 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 758532 | 758804 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 768558 | 768830 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01402.23 | 1.0 | 2 | 3300.0 | opposite-strand | Ribbon-helix-helix protein, copG family |
| 2 | PF01850.23 | 1.0 | 2 | -3 | same-strand | PIN domain |
| 3 | PF00884.25 | 1.0 | 2 | 32.0 | same-strand | Sulfatase |
| 4 | PF13385.8 | 1.0 | 2 | 32.0 | same-strand | Concanavalin A-like lectin/glucanases superfamily |
| 5 | PF00562.30 | 1.0 | 2 | 1040.5 | same-strand | RNA polymerase Rpb2, domain 6 |
| 6 | PF10385.11 | 1.0 | 2 | 1040.5 | same-strand | RNA polymerase beta subunit external 1 domain |
| 7 | PF04565.18 | 1.0 | 2 | 1040.5 | same-strand | RNA polymerase Rpb2, domain 3 |
| 8 | PF04561.16 | 1.0 | 2 | 1040.5 | same-strand | RNA polymerase Rpb2, domain 2 |
| 9 | PF04560.22 | 1.0 | 2 | 1040.5 | same-strand | RNA polymerase Rpb2, domain 7 |
| 10 | PF04997.14 | 1.0 | 2 | 4603.5 | same-strand | RNA polymerase Rpb1, domain 1 |
| 11 | PF04998.19 | 1.0 | 2 | 4603.5 | same-strand | RNA polymerase Rpb1, domain 5 |
| 12 | PF00623.22 | 1.0 | 2 | 4603.5 | same-strand | RNA polymerase Rpb1, domain 2 |
| 13 | PF04983.20 | 1.0 | 2 | 4603.5 | same-strand | RNA polymerase Rpb1, domain 3 |
++ More..