Result : O06722
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl-phosphate phosphatase YisI (EC 3.1.3.-) (Stage 0 sporulation regulatory protein YisI) |
| NCBI Accession ID | Y09476.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 8048 |
| Right | 8218 |
| Strand | - |
| Nucleotide Sequence | ATGAACAGTAAAATTGAAGAAATGAGGATCACACTAATTGAAACCGCACAAAAATACGGCATGAATTCAAAAGAAACGATTCAATGCAGCCAAGAGCTGGATATCCTGCTGAATACCCGGATTAAAGAAGAAATGATTTTTGGGAGATATCTTGAAAACTCCCGTATGTAA |
| Sequence | MNSKIEEMRITLIETAQKYGMNSKETIQCSQELDILLNTRIKEEMIFGRYLENSRM |
| Source of smORF | Swiss-Prot |
| Function | Aspartyl-phosphate phosphatase which specifically dephosphorylates the sporulation transcription factor Spo0A-P and negatively regulates the sporulation initiation pathway in order to control the proper timing of sporulation. {ECO:0000269|Pubmed:11679073}. |
| Pubmed ID | 9353931 9384377 11679073 |
| Domain | CDD:401369 |
| Functional Category | Others |
| Uniprot ID | O06722 |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1150850 | 1151020 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1124438 | 1124608 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1319642 | 1319812 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 1129762 | 1129932 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 1083514 | 1083684 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 1155244 | 1155408 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 551724 | 551903 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10737.11 | 0.86 | 6 | 912.0 | same-strand | Spore germination protein GerPC |
| 2 | PF10803.10 | 1.0 | 7 | 658 | same-strand | Spore germination GerPB |
| 3 | PF10676.11 | 1.0 | 7 | 458.0 | same-strand | Spore germination protein gerPA/gerPF |
| 4 | PF01557.20 | 1.0 | 7 | 1221 | opposite-strand | Fumarylacetoacetate (FAA) hydrolase family |
| 5 | PF07457.13 | 1.0 | 7 | 2243 | opposite-strand | Protein of unknown function (DUF1516) |
| 6 | PF00082.24 | 0.86 | 6 | 2767.5 | opposite-strand | Subtilase family |
| 7 | PF17936.3 | 0.86 | 6 | 2767.5 | opposite-strand | Bacterial Ig domain |
| 8 | PF10949.10 | 1.0 | 7 | 5482 | same-strand | Protein of unknown function (DUF2777) |
++ More..