Result : O06720
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable spore germination protein GerPB |
| NCBI Accession ID | Y09476.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 7156 |
| Right | 7389 |
| Strand | - |
| Nucleotide Sequence | ATGAACTTCTATATTAATCAAACCATTCAAATCAACTATCTCCGGCTGGAATCAATCAGCAACTCCTCCATTCTGCAAATCGGGAGCGCCGGATCAATCAAGTCACTGTCAAATTTGTATAATACAGGAAGCTATGTAGAGCCGGCACCAGAAGTTTCTGGCTCAGGGCAACCGCTCCAGCTGCAGGAGCCCGACACAGGTTCATTGGTCCCGCTCCAGCCTCCTGGCCGTTAA |
| Sequence | MNFYINQTIQINYLRLESISNSSILQIGSAGSIKSLSNLYNTGSYVEPAPEVSGSGQPLQLQEPDTGSLVPLQPPGR |
| Source of smORF | Swiss-Prot |
| Function | Required for the formation of functionally normal spores. Could be involved in the establishment of normal spore coat structure and/or permeability, which allows the access of germinants to their receptor. |
| Pubmed ID | 9353931 9384377 10715007 |
| Domain | CDD:393434 |
| Functional Category | Others |
| Uniprot ID | O06720 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 26
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1149958 | 1150191 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1123552 | 1123785 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1154282 | 1154515 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 4 | 1318764 | 1318997 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 1128871 | 1129104 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 839888 | 840121 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1082651 | 1082884 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 1067729 | 1067965 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2878902 | 2879138 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 578656 | 578889 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 11 | 447039 | 447272 | + | NZ_CP043404.1 | Bacillus safensis |
| 12 | 1049344 | 1049577 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 13 | 1174433 | 1174675 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 1263385 | 1263630 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 15 | 2020756 | 2020965 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 16 | 3193068 | 3193301 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 889447 | 889677 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 18 | 1402031 | 1402255 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 19 | 1651601 | 1651804 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 20 | 1355869 | 1356075 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 21 | 1304978 | 1305208 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 22 | 909316 | 909543 | - | NZ_CP012024.1 | Bacillus smithii |
| 23 | 208133 | 208345 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 24 | 2864122 | 2864337 | - | NZ_AP019400.1 | Cohnella abietis |
| 25 | 5606667 | 5606867 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 26 | 1063527 | 1063730 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10676.11 | 1.0 | 26 | 301 | same-strand | Spore germination protein gerPA/gerPF |
| 2 | PF10970.10 | 0.88 | 23 | 832 | same-strand | Spore germination protein GerPE |
| 3 | PF10737.11 | 0.96 | 25 | 31 | same-strand | Spore germination protein GerPC |
| 4 | PF09388.12 | 0.62 | 16 | 649.0 | same-strand | Spo0E like sporulation regulatory protein |
| 5 | PF01557.20 | 0.62 | 16 | 2046.5 | opposite-strand | Fumarylacetoacetate (FAA) hydrolase family |
++ More..