Result : O06716
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable spore germination protein GerPF |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1148494 |
| Right | 1148712 |
| Strand | - |
| Nucleotide Sequence | ATGCCAGCAATTGTCGGGCCTATAGCTATCAATTCCATATCGGGCGGAGTCGTAAACTTTGGTGATTCCTTTTACCTTTCTCCGAAAAGCTCTTCAAAATCTGCGCTCGGTTCGGGAGCAGGAAACACGGGAGATTTCCTTCTATTAAATAATGCAGTCAACGCGACAAATTATATAGACCCCGATGTCAACGATCAGGATATGGTTGGAAACGGATAA |
| Sequence | MPAIVGPIAINSISGGVVNFGDSFYLSPKSSSKSALGSGAGNTGDFLLLNNAVNATNYIDPDVNDQDMVGNG |
| Source of smORF | Swiss-Prot |
| Function | Required for the formation of functionally normal spores. Could be involved in the establishment of normal spore coat structure and/or permeability, which allows the access of germinants to their receptor. |
| Pubmed ID | 9353931 9384377 10715007 |
| Domain | CDD:371190 |
| Functional Category | Others |
| Uniprot ID | O06716 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 56
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1148494 | 1148712 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1317299 | 1317517 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 3125921 | 3126142 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 1081187 | 1081405 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 1152819 | 1153037 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 1127407 | 1127625 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 7 | 841368 | 841586 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1122086 | 1122304 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 9 | 2880399 | 2880617 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 2878668 | 2878889 | + | NZ_CP011937.1 | Bacillus velezensis |
| 11 | 1066250 | 1066468 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 12 | 1067978 | 1068199 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 13 | 1228480 | 1228698 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 14 | 448544 | 448762 | + | NZ_CP043404.1 | Bacillus safensis |
| 15 | 1261919 | 1262137 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 16 | 1172974 | 1173192 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 17 | 580165 | 580383 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 18 | 1047850 | 1048068 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 19 | 1276119 | 1276337 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 20 | 895319 | 895537 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 21 | 887524 | 887742 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 22 | 887914 | 888132 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 23 | 1473388 | 1473606 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 24 | 2948480 | 2948698 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 25 | 3001997 | 3002215 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 26 | 945690 | 945905 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 27 | 1127834 | 1128052 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 28 | 623281 | 623499 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 29 | 3194625 | 3194843 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 30 | 704038 | 704259 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 31 | 473670 | 473888 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 32 | 1449398 | 1449616 | - | NZ_CP053989.1 | Niallia circulans |
| 33 | 1449125 | 1449343 | - | NZ_CP053989.1 | Niallia circulans |
| 34 | 2019169 | 2019387 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 35 | 3293009 | 3293230 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 36 | 3290623 | 3290847 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 37 | 3290998 | 3291222 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 38 | 1303506 | 1303724 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 39 | 1683142 | 1683360 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 40 | 708996 | 709217 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 41 | 711381 | 711605 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 42 | 711006 | 711230 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 43 | 3375867 | 3376088 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 44 | 3378252 | 3378476 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 45 | 3377877 | 3378101 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 46 | 1576555 | 1576776 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 47 | 1574167 | 1574391 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 48 | 1574542 | 1574766 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 49 | 1014920 | 1015141 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 50 | 1016930 | 1017154 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 51 | 206567 | 206788 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 52 | 2586376 | 2586597 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 53 | 2583985 | 2584209 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 54 | 546689 | 546910 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 55 | 548582 | 548806 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 56 | 548357 | 548578 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 57 | 1400517 | 1400738 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 58 | 1402920 | 1403144 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 59 | 6763307 | 6763519 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 60 | 1331257 | 1331475 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 61 | 3173086 | 3173310 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 62 | 151187 | 151405 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 63 | 2494438 | 2494659 | - | NZ_CP021434.1 | Tumebacillus avium |
| 64 | 3184817 | 3185035 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 65 | 4340262 | 4340498 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 66 | 5606428 | 5606670 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 67 | 2864337 | 2864573 | - | NZ_AP019400.1 | Cohnella abietis |
| 68 | 438495 | 438713 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 69 | 4894588 | 4894824 | + | NZ_CP034437.1 | Paenibacillus albus |
| 70 | 1063730 | 1063963 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 71 | 3724139 | 3724360 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 72 | 6146420 | 6146647 | + | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 73 | 2413435 | 2413650 | - | NZ_CP026363.1 | Brevibacillus agri |
| 74 | 6380127 | 6380363 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 75 | 2209378 | 2209593 | - | NZ_LR134338.1 | Brevibacillus brevis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12705.9 | 0.68 | 38 | 8502 | opposite-strand | PD-(D/E)XK nuclease superfamily |
| 2 | PF13361.8 | 0.7 | 39 | 4979 | opposite-strand | UvrD-like helicase C-terminal domain |
| 3 | PF00580.23 | 0.68 | 38 | 4773.0 | opposite-strand | UvrD/REP helicase N-terminal domain |
| 4 | PF13245.8 | 0.66 | 37 | 4773 | opposite-strand | AAA domain |
| 5 | PF10970.10 | 0.88 | 49 | 61.0 | same-strand | Spore germination protein GerPE |
| 6 | PF10737.11 | 0.88 | 49 | 606.5 | same-strand | Spore germination protein GerPC |
| 7 | PF10803.10 | 0.93 | 52 | 1246 | same-strand | Spore germination GerPB |
| 8 | PF10676.11 | 0.79 | 44 | 1470 | same-strand | Spore germination protein gerPA/gerPF |
++ More..