Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YisB |
NCBI Accession ID | Y09476.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 5353 |
Right | 5655 |
Strand | + |
Nucleotide Sequence | ATGGCAAAGCAGATTGCCGGAATATGTGAGCTGTGCGGCCGGAGCGATGTCCAGCTGACAGAGCATCATCTTACACCGAAAGAGGAAGGCGGAACGTTTTTGCCGACAGCGATGCTCTGTATTCCTTGTCATAAACAGATTCATGCCTTATATACCAATCAAGAGCTCGCTGTACGTTTAAATGGAATGGCTGAACTCAGAAGCGATCCAGAGCTTGCCCGGTTTGTCAAATGGATCAGAAAACAGCCGCCTGAGAAGCTGATCAAAACTAAGAAATCAAATGAACGAAAAAAGAAAAAATGA |
Sequence | MAKQIAGICELCGRSDVQLTEHHLTPKEEGGTFLPTAMLCIPCHKQIHALYTNQELAVRLNGMAELRSDPELARFVKWIRKQPPEKLIKTKKSNERKKKK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00083. Profile Description: N/A. WHH is a predicted nuclease of the HNH/ENDO VII superfamily of the treble clef fold. The name is derived from the conserved motif WHH. It is found in bacterial polymorphic toxin systems and functions as a toxin module. WHH is the shortest version of HNH nuclease families. Like AHH and LHH, the WHH nuclease contains 4 conserved histidines of which the first one is predicted to bind a metal-ion and other three ones are involved in activation of water molecule for hydrolysis. |
Pubmed ID | 9353931 9384377 |
Domain | CDD:412150 |
Functional Category | Others |
Uniprot ID | O06715 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1148155 | 1148457 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1080848 | 1081150 | + | NZ_CP048852.1 | Bacillus tequilensis |
3 | 1121747 | 1122049 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
4 | 1127068 | 1127370 | + | NZ_CP013984.1 | Bacillus inaquosorum |
5 | 841620 | 841922 | - | NZ_CP029364.1 | Bacillus halotolerans |
6 | 1316960 | 1317262 | + | NZ_CP033052.1 | Bacillus vallismortis |
7 | 1152483 | 1152785 | + | NZ_CP051464.1 | Bacillus mojavensis |
8 | 1065913 | 1066206 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
9 | 2880661 | 2880954 | - | NZ_CP011937.1 | Bacillus velezensis |
10 | 3195039 | 3195347 | - | NZ_CP016020.1 | Bacillus weihaiensis |
11 | 448810 | 449109 | - | NZ_CP043404.1 | Bacillus safensis |
12 | 2009920 | 2010225 | - | NZ_CP008876.1 | Terribacillus goriensis |
13 | 580431 | 580730 | - | NZ_CP017786.1 | Bacillus xiamenensis |
14 | 1047503 | 1047802 | + | NZ_CP011150.1 | Bacillus altitudinis |
15 | 1303219 | 1303461 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
16 | 492901 | 493191 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
17 | 622986 | 623234 | + | NZ_CP024035.1 | Priestia aryabhattai |
18 | 177439 | 177756 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
19 | 653373 | 653621 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
20 | 546423 | 546692 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
21 | 2615485 | 2615748 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
22 | 887099 | 887410 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
23 | 1444479 | 1444772 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
24 | 728286 | 728567 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
25 | 779751 | 780005 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
26 | 1887631 | 1887876 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
27 | 2841870 | 2842175 | + | NC_008261.1 | Clostridium perfringens ATCC 13124 |
28 | 3002425 | 3002712 | - | NZ_CP020772.1 | Halobacillus mangrovi |
29 | 3686373 | 3686678 | - | NZ_CP009285.1 | Paenibacillus borealis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12705.9 | 0.66 | 19 | 8335 | same-strand | PD-(D/E)XK nuclease superfamily |
2 | PF13361.8 | 0.76 | 22 | 4650.0 | same-strand | UvrD-like helicase C-terminal domain |
3 | PF00580.23 | 0.76 | 22 | 4642.0 | same-strand | UvrD/REP helicase N-terminal domain |
4 | PF13245.8 | 0.76 | 22 | 4642.0 | same-strand | AAA domain |
5 | PF10676.11 | 0.62 | 18 | 47 | opposite-strand | Spore germination protein gerPA/gerPF |