Result : O06261
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ESAT-6-like protein EsxT |
| NCBI Accession ID | AE000516.2 |
| Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Left | 3848573 |
| Right | 3848875 |
| Strand | - |
| Nucleotide Sequence | ATGAACGCAGACCCCGTGTTGTCGTACAACTTTGACGCCATCGAATACTCCGTTCGTCAGGAGATCCACACCACCGCGGCCCGTTTCAACGCTGCGCTGCAAGAGCTGAGGTCGCAGATCGCGCCGTTGCAGCAGCTCTGGACACGGGAAGCGGCCGCCGCCTACCACGCGGAGCAACTCAAGTGGCACCAGGCGGCCAGCGCGCTCAACGAGATCCTGATCGACTTGGGAAACGCGGTTCGCCACGGTGCCGACGACGTGGCGCATGCCGACCGGCGGGCGGCTGGAGCTTGGGCACGCTAG |
| Sequence | MNADPVLSYNFDAIEYSVRQEIHTTAARFNAALQELRSQIAPLQQLWTREAAAAYHAEQLKWHQAASALNEILIDLGNAVRHGADDVAHADRRAAGAWAR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl02005. Profile Description: Proteins of 100 residues with WXG. T7SS_ESX-EspC is a family of exported virulence proteins from largely Acinetobacteria and a few Fimicutes, Gram-positive bacteria. It is exported in conjunction with EspA as an interacting pair.ED F8ADQ6.1/227-313; F8ADQ6.1/227-313; |
| Pubmed ID | 12218036 17088352 |
| Domain | CDD:413154 |
| Functional Category | Others |
| Uniprot ID | O06261 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 65
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3862624 | 3862926 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 3921823 | 3922125 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 4385429 | 4385731 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 4 | 2856613 | 2856864 | - | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 5 | 2617819 | 2618070 | - | NZ_AP022576.1 | Mycobacterium florentinum |
| 6 | 2799494 | 2799781 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 7 | 2935839 | 2936126 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 8 | 1030148 | 1030399 | + | NZ_AP018164.1 | Mycobacterium shigaense |
| 9 | 2745895 | 2746191 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 10 | 839155 | 839439 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 11 | 3923333 | 3923629 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 12 | 2808042 | 2808338 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 13 | 5270303 | 5270554 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 14 | 4819474 | 4819770 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 15 | 5073431 | 5073682 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 16 | 1058307 | 1058591 | + | NZ_LR130759.1 | Mycobacterium basiliense |
| 17 | 4315306 | 4315557 | - | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 18 | 707602 | 707889 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 19 | 4534909 | 4535196 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 20 | 1633074 | 1633325 | - | NZ_AP022568.1 | Mycobacterium simiae |
| 21 | 1292306 | 1292602 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 22 | 2392188 | 2392475 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 23 | 5754594 | 5754842 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 24 | 1353214 | 1353510 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 25 | 3266766 | 3267017 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 26 | 1574213 | 1574509 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 27 | 3200989 | 3201240 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 28 | 6332819 | 6333115 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 29 | 3646230 | 3646526 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 30 | 4618150 | 4618401 | - | NC_016948.1 | Mycobacterium paraintracellulare |
| 31 | 6678246 | 6678533 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 32 | 715755 | 716051 | + | NZ_AP022605.1 | Mycobacterium doricum |
| 33 | 2741922 | 2742209 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 34 | 182550 | 182846 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 35 | 1704689 | 1704976 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 36 | 488636 | 488887 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 37 | 5635490 | 5635777 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 38 | 4484288 | 4484539 | - | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 39 | 355746 | 356042 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 40 | 1246967 | 1247218 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 41 | 1556645 | 1556941 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 42 | 3405696 | 3405947 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 43 | 1761447 | 1761743 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 44 | 5446776 | 5447063 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 45 | 4578890 | 4579186 | + | NZ_AP022569.1 | Mycobacterium cookii |
| 46 | 5403066 | 5403362 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 47 | 1094757 | 1095008 | + | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 48 | 1203172 | 1203468 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 49 | 3925309 | 3925560 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 50 | 5298224 | 5298472 | + | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 51 | 1147352 | 1147603 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 52 | 1275137 | 1275388 | + | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 53 | 2529155 | 2529451 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 54 | 2350632 | 2350928 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 55 | 1021338 | 1021634 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 56 | 3931982 | 3932233 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 57 | 3447138 | 3447434 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 58 | 2461415 | 2461711 | + | NZ_CP043474.1 | Mycobacterium grossiae |
| 59 | 5114665 | 5114961 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 60 | 4627469 | 4627765 | - | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 61 | 2124100 | 2124396 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 62 | 1493496 | 1493744 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 63 | 3368570 | 3368824 | + | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 64 | 3615766 | 3616059 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 65 | 587966 | 588214 | - | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00380.21 | 0.63 | 41 | 693 | same-strand | Ribosomal protein S9/S16 |
| 2 | PF00572.20 | 0.74 | 48 | 257.0 | same-strand | Ribosomal protein L13 |
| 3 | PF06013.14 | 1.0 | 65 | 26 | same-strand | Proteins of 100 residues with WXG |
| 4 | PF01580.20 | 0.89 | 58 | 1585.5 | same-strand | FtsK/SpoIIIE family |
| 5 | PF08817.12 | 0.97 | 63 | 5375 | opposite-strand | WXG100 protein secretion system (Wss), protein YukD |
| 6 | PF00082.24 | 0.92 | 60 | 6718.0 | opposite-strand | Subtilase family |
++ More..