Result : O06011
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YraE |
| NCBI Accession ID | X92868.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 13509 |
| Right | 13706 |
| Strand | - |
| Nucleotide Sequence | ATGGAATACGCCTTACACGAAGTGCTTGAGGTTCAGGAAATGACTGCATTTAAGACACTTTGTTTGACGAAATCTAAAACAATGAAAGCACTGGTATCTGATCCGAAGCTGAAAGAAATCATGCAGCAAGATGTTGATATCACCACACGCCAGTTGCAGGAATTTGCCTCTATTTTATCTAATGCAAAGCAAGAATGA |
| Sequence | MEYALHEVLEVQEMTAFKTLCLTKSKTMKALVSDPKLKEIMQQDVDITTRQLQEFASILSNAKQE |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9141695 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O06011 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 24
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2754607 | 2754804 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2582993 | 2583190 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2560517 | 2560714 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2641836 | 2642033 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 199535 | 199729 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 6 | 569630 | 569827 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 7 | 3383629 | 3383826 | + | NZ_CP011937.1 | Bacillus velezensis |
| 8 | 879371 | 879568 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 9 | 1536741 | 1536935 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 10 | 2691327 | 2691521 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 11 | 1200616 | 1200810 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 12 | 2601022 | 2601243 | + | NZ_CP053989.1 | Niallia circulans |
| 13 | 4644752 | 4644946 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 14 | 2140431 | 2140643 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 15 | 517999 | 518220 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 16 | 1662564 | 1662731 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 17 | 1264512 | 1264718 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 18 | 851432 | 851635 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 19 | 212636 | 212815 | + | NZ_CP045296.1 | Paenibacillus cellulositrophicus |
| 20 | 5396412 | 5396606 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 21 | 5781565 | 5781738 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 22 | 28064 | 28234 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 23 | 2120436 | 2120606 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 24 | 54319 | 54480 | + | NZ_CP029364.1 | Bacillus halotolerans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07875.14 | 1.0 | 24 | 307.5 | same-strand | Coat F domain |
| 2 | PF08240.14 | 0.96 | 23 | 20.0 | same-strand | Alcohol dehydrogenase GroES-like domain |
| 3 | PF13823.8 | 0.96 | 23 | 20 | same-strand | Alcohol dehydrogenase GroES-associated |
++ More..