Result : O06010
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Spore coat protein F-like protein YraD |
| NCBI Accession ID | X92868.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 13194 |
| Right | 13493 |
| Strand | - |
| Nucleotide Sequence | ATGAATCCTATCATAGAATATCTGACTGGCATGAATGTTCTAACAGACCAAATCATTGCTATGGACTTATTAATTTCAGCAAAGAACGGAGTCAGAAATTATGCGATGGCAGCCACTGAAGCCGGAACGCCTGAAGTAAAAGAGGTCCTTATCCGCCATTTGGAAGAAGCACTCGATATGCACGAACAACTCTCAAGCTATATGATGGAAAAAGGCTGGTACCATCCTTGGAACCCTGACGAACAAGTCAAGCTGAATTTAAAAAATATTGATACAGCCATTCAATTGCCAACCCTTTAA |
| Sequence | MNPIIEYLTGMNVLTDQIIAMDLLISAKNGVRNYAMAATEAGTPEVKEVLIRHLEEALDMHEQLSSYMMEKGWYHPWNPDEQVKLNLKNIDTAIQLPTL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl17715. Profile Description: Coat F domain. The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in. |
| Pubmed ID | 9141695 9384377 |
| Domain | CDD:418458 |
| Functional Category | Others |
| Uniprot ID | O06010 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2754820 | 2755119 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2583206 | 2583505 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2642049 | 2642348 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 2560730 | 2561029 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 569316 | 569615 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 6 | 3383842 | 3384141 | + | NZ_CP011937.1 | Bacillus velezensis |
| 7 | 199748 | 200047 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 8 | 1536423 | 1536722 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 9 | 2691540 | 2691839 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 10 | 1200298 | 1200597 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 11 | 2601240 | 2601539 | + | NZ_CP053989.1 | Niallia circulans |
| 12 | 879058 | 879357 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 13 | 4644959 | 4645258 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 14 | 2140640 | 2140939 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 15 | 5396621 | 5396914 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 16 | 3665252 | 3665548 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 17 | 851653 | 851946 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 18 | 1264211 | 1264507 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 19 | 5781257 | 5781553 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 20 | 517722 | 518015 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 21 | 1664008 | 1664307 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 22 | 212812 | 213117 | + | NZ_CP045296.1 | Paenibacillus cellulositrophicus |
| 23 | 1381214 | 1381507 | + | NZ_CP033433.1 | Cohnella candidum |
| 24 | 3242068 | 3242373 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 25 | 1662754 | 1663047 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 26 | 28257 | 28559 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 27 | 2120629 | 2120931 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 28 | 1944862 | 1945161 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 29 | 1911942 | 1912241 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 30 | 1397690 | 1397944 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 31 | 1556424 | 1556708 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 32 | 992936 | 993220 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07875.14 | 0.88 | 28 | 1386 | same-strand | Coat F domain |
| 2 | PF08240.14 | 0.88 | 28 | 239 | same-strand | Alcohol dehydrogenase GroES-like domain |
| 3 | PF13823.8 | 0.88 | 28 | 238.0 | same-strand | Alcohol dehydrogenase GroES-associated |
++ More..