Result : O05524
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized lipoprotein YdiK |
| NCBI Accession ID | D88802.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 34760 |
| Right | 34951 |
| Strand | - |
| Nucleotide Sequence | ATGAGAAACCCGGTAGTTTGGGGAATGATCTACTTTGCCGTAGGGTGCATCTTTACTTATCTTGCCGCAAGCTCGCCAGGCAGCATGTGGTCATTTTACTCCATCCTGCTGATGGTGTTCGCCGCTTACAACATCAGCATTTCTTTTAAGATGTTCGCCTTTTCATTTAAAATCAAAAAGAACCAAAAATAA |
| Sequence | MRNPVVWGMIYFAVGCIFTYLAASSPGSMWSFYSILLMVFAAYNISISFKMFAFSFKIKKNQK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14146. Profile Description: Domain of unknown function (DUF4305). This family includes the B. subtilis YdiK protein, which is functionally uncharacterized. This is not a homolog of E. coli YdiK, which belongs to pfam01594. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length. |
| Pubmed ID | 9202461 9384377 |
| Domain | CDD:316654 |
| Functional Category | Others |
| Uniprot ID | O05524 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 622591 | 622782 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 2 | 602423 | 602614 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 648742 | 648933 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 4 | 638056 | 638247 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 1353556 | 1353747 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 795499 | 795690 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 648706 | 648897 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 3330417 | 3330608 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 622913 | 623104 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 1041300 | 1041494 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 11 | 605456 | 605650 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 12 | 948900 | 949094 | + | NZ_CP043404.1 | Bacillus safensis |
| 13 | 695674 | 695865 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 14 | 625440 | 625631 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 15 | 679705 | 679884 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048852.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.8 | 12 | 2288.5 | same-strand | ABC transporter |
| 2 | PF12848.9 | 0.8 | 12 | 2288.5 | same-strand | ABC transporter |
| 3 | PF02463.21 | 0.8 | 12 | 2288.5 | same-strand | RecF/RecN/SMC N terminal domain |
| 4 | PF16326.7 | 0.8 | 12 | 2288.5 | same-strand | ABC transporter C-terminal domain |
| 5 | PF01967.23 | 0.93 | 14 | 1649.5 | opposite-strand | MoaC family |
| 6 | PF02629.21 | 0.93 | 14 | 1005.5 | opposite-strand | CoA binding domain |
| 7 | PF06971.15 | 0.93 | 14 | 1005.5 | opposite-strand | Putative DNA-binding protein N-terminus |
| 8 | PF02416.18 | 1.0 | 15 | 810 | opposite-strand | mttA/Hcf106 family |
| 9 | PF00902.20 | 1.0 | 15 | 42 | opposite-strand | Sec-independent protein translocase protein (TatC) |
| 10 | PF02517.18 | 1.0 | 15 | -3 | same-strand | Type II CAAX prenyl endopeptidase Rce1-like |
| 11 | PF00166.23 | 1.0 | 15 | 968 | opposite-strand | Chaperonin 10 Kd subunit |
| 12 | PF00118.26 | 1.0 | 15 | 1300 | opposite-strand | TCP-1/cpn60 chaperonin family |
++ More..