| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YrhK |
| NCBI Accession ID | U93874.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 13480 |
| Right | 13770 |
| Strand | - |
| Nucleotide Sequence | ATGAAAGGAAATGAAGAACATGACATCCAAAAAGAGTTGAAACGATATGAGCTTTTTTTCAAAAAACGATATAAGGTTCTTTATACAGTAAACGATTTTATCATCGGTGCTATGTTTCTCGTTGGAAGTTTTTTCTTTTTTTATGACCGGTTAATGTCGGCAGGGATATGGCTGTTTGCGATCGGAAGTTTGCTGCTGTTAATCAGGCCGACCATTCGGCTGATTCATGACTTTCATTACCGTAAGCATGTGGAACAGCAATTCAAGCATCAATCTTCAACAGATGACTGA |
| Sequence | MKGNEEHDIQKELKRYELFFKKRYKVLYTVNDFIIGAMFLVGSFFFFYDRLMSAGIWLFAIGSLLLLIRPTIRLIHDFHYRKHVEQQFKHQSSTDD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14145. Profile Description: YrhK-like protein. The YrhK-like protein family includes the B. subtilis YrhK protein, which is functionally uncharacterized. Its expression is under the control of the motility sigma factor sigma-D. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 60 amino acids in length. |
| Pubmed ID | 9308178 9384377 |
| Domain | CDD:404941 |
| Functional Category | Others |
| Uniprot ID | O05401 |
| ORF Length (Amino Acid) | 96 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2773356 | 2773646 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2583923 | 2584219 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 2606020 | 2606307 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2654799 | 2655095 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2509510 | 2509797 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 3524090 | 3524377 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2721512 | 2721772 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 8 | 2905994 | 2906254 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 9 | 2097480 | 2097752 | - | NZ_CP008876.1 | Terribacillus goriensis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01810.20 | 0.67 | 6 | 4709.0 | opposite-strand | LysE type translocator |
| 2 | PF01978.21 | 0.67 | 6 | 3730.0 | same-strand | Sugar-specific transcriptional regulator TrmB |
| 3 | PF00067.24 | 0.67 | 6 | 262.5 | opposite-strand | Cytochrome P450 |
| 4 | PF00667.22 | 0.67 | 6 | 262.5 | opposite-strand | FAD binding domain |
| 5 | PF00258.27 | 0.67 | 6 | 262.5 | opposite-strand | Flavodoxin |
| 6 | PF00175.23 | 0.67 | 6 | 262.5 | opposite-strand | Oxidoreductase NAD-binding domain |
| 7 | PF16295.7 | 0.67 | 6 | 3442.0 | opposite-strand | Tetracyclin repressor-like, C-terminal domain |
| 8 | PF00440.25 | 0.67 | 6 | 3442.0 | opposite-strand | Bacterial regulatory proteins, tetR family |
| 9 | PF08241.14 | 0.67 | 6 | 4252.5 | opposite-strand | Methyltransferase domain |
| 10 | PF13649.8 | 0.67 | 6 | 4252.5 | opposite-strand | Methyltransferase domain |
| 11 | PF08242.14 | 0.67 | 6 | 4252.5 | opposite-strand | Methyltransferase domain |
| 12 | PF09501.12 | 0.67 | 6 | 5300.5 | opposite-strand | Probable sporulation protein (Bac small yrzI) |