Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YrhC |
NCBI Accession ID | U93874.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 2208 |
Right | 2438 |
Strand | + |
Nucleotide Sequence | TTGAACAAAAATAGAATGAAATCTTTAAAAGAAGACTACAAGCATTTTGCTTTTACATTGCTTGCAGTCAGCACTTTTTTATATATAGGCGCAGTTCTCCCTGATCAAGGCTTAACATTAGGCCAGAAATCGACGATGTTTTTAGCGGATTGCGTATTTTTAGCCGGTGCCTTCTTTTGCGCTGACCGTTCACTTATTTACAAGAAGCGTCTGGAAGAAGCCGACGAATAA |
Sequence | MNKNRMKSLKEDYKHFAFTLLAVSTFLYIGAVLPDQGLTLGQKSTMFLADCVFLAGAFFCADRSLIYKKRLEEADE |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam14143. Profile Description: YrhC-like protein. The YrhC-like protein family includes the B. subtilis YrhC protein, which is functionally uncharacterized. YrhC is on the same operon as the MccA and MccB genes, which are involved in the conversion of methionine to cysteine. Expression of this operon is repressed in the presence of sulphate or cysteine. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length. |
Pubmed ID | 9308178 9384377 |
Domain | CDD:372926 |
Functional Category | Others |
Uniprot ID | O05395 |
ORF Length (Amino Acid) | 76 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2617395 | 2617625 | - | NZ_CP013984.1 | Bacillus inaquosorum |
2 | 2784688 | 2784918 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
3 | 2602987 | 2603217 | - | NZ_CP048852.1 | Bacillus tequilensis |
4 | 2520948 | 2521178 | - | NZ_CP051464.1 | Bacillus mojavensis |
5 | 3512703 | 3512933 | + | NZ_CP029364.1 | Bacillus halotolerans |
6 | 2595258 | 2595488 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
7 | 2668113 | 2668343 | - | NZ_CP033052.1 | Bacillus vallismortis |
8 | 1357077 | 1357307 | + | NZ_CP011937.1 | Bacillus velezensis |
9 | 2630732 | 2630962 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 2933366 | 2933599 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
11 | 2742661 | 2742894 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
12 | 3076060 | 3076293 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
13 | 2402477 | 2402683 | - | NZ_CP011150.1 | Bacillus altitudinis |
14 | 2985334 | 2985540 | + | NZ_CP017786.1 | Bacillus xiamenensis |
15 | 2902517 | 2902723 | + | NZ_CP043404.1 | Bacillus safensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF09501.12 | 0.67 | 10 | 446.5 | same-strand | Probable sporulation protein (Bac small yrzI) |
2 | PF00384.24 | 0.6 | 9 | 538 | opposite-strand | Molybdopterin oxidoreductase |
3 | PF01568.23 | 0.6 | 9 | 538 | opposite-strand | Molydopterin dinucleotide binding domain |
4 | PF04879.18 | 0.6 | 9 | 538 | opposite-strand | Molybdopterin oxidoreductase Fe4S4 domain |
5 | PF13510.8 | 0.6 | 9 | 538 | opposite-strand | 2Fe-2S iron-sulfur cluster binding domain |
6 | PF10588.11 | 0.6 | 9 | 538 | opposite-strand | NADH-ubiquinone oxidoreductase-G iron-sulfur binding region |
7 | PF00037.29 | 0.6 | 9 | 538 | opposite-strand | 4Fe-4S binding domain |
8 | PF12838.9 | 0.6 | 9 | 538 | opposite-strand | 4Fe-4S dicluster domain |
9 | PF14697.8 | 0.6 | 9 | 538 | opposite-strand | 4Fe-4S dicluster domain |
10 | PF12837.9 | 0.6 | 9 | 538 | opposite-strand | 4Fe-4S binding domain |
11 | PF13237.8 | 0.6 | 9 | 538 | opposite-strand | 4Fe-4S dicluster domain |
12 | PF13187.8 | 0.6 | 9 | 538 | opposite-strand | 4Fe-4S dicluster domain |
13 | PF13183.8 | 0.6 | 9 | 538 | opposite-strand | 4Fe-4S dicluster domain |
14 | PF07849.13 | 0.6 | 9 | 37 | opposite-strand | Protein of unknown function (DUF1641) |
15 | PF01053.22 | 1.0 | 15 | 85 | same-strand | Cys/Met metabolism PLP-dependent enzyme |
16 | PF00291.27 | 1.0 | 15 | 1228 | same-strand | Pyridoxal-phosphate dependent enzyme |
17 | PF01048.22 | 1.0 | 15 | 2211 | same-strand | Phosphorylase superfamily |
18 | PF13649.8 | 1.0 | 15 | 2925 | same-strand | Methyltransferase domain |
19 | PF08241.14 | 1.0 | 15 | 2925 | same-strand | Methyltransferase domain |
20 | PF13489.8 | 0.93 | 14 | 2926 | same-strand | Methyltransferase domain |
21 | PF08242.14 | 1.0 | 15 | 2925 | same-strand | Methyltransferase domain |
22 | PF10750.11 | 1.0 | 15 | 3759 | opposite-strand | Protein of unknown function (DUF2536) |