Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YufS |
NCBI Accession ID | Z93937.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 10019 |
Right | 10234 |
Strand | - |
Nucleotide Sequence | GTGAAAACAAAAGTCGTGATGTGCTCAGGTTTATTCTGCTCAGTATTTGCAGGGGCATTCATGTTGAATCAATATGACGGGCGCAGCGGTGTGGCGGCTTGTGATGAGTGGGAGCTGTATTTACTGGAGCACCACCTGTCAGCCAGAATGAGTGAGACGGAATCAAAGGATCTGCCGTTTGGTCCCCGAGAGTATATTCGGATTGTGAATAAATAA |
Sequence | MKTKVVMCSGLFCSVFAGAFMLNQYDGRSGVAACDEWELYLLEHHLSARMSETESKDLPFGPREYIRIVNK |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9274030 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O05257 |
ORF Length (Amino Acid) | 71 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3246152 | 3246367 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 3109750 | 3109965 | - | NZ_CP033052.1 | Bacillus vallismortis |
3 | 3040144 | 3040359 | - | NZ_CP048852.1 | Bacillus tequilensis |
4 | 3110142 | 3110354 | - | NZ_CP013984.1 | Bacillus inaquosorum |
5 | 3047038 | 3047253 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
6 | 3032930 | 3033145 | - | NZ_CP051464.1 | Bacillus mojavensis |
7 | 3016493 | 3016708 | + | NZ_CP029364.1 | Bacillus halotolerans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03390.17 | 1.0 | 7 | 38 | opposite-strand | 2-hydroxycarboxylate transporter family |
2 | PF00361.22 | 1.0 | 7 | 1809.5 | opposite-strand | Proton-conducting membrane transporter |
3 | PF13244.8 | 1.0 | 7 | 232 | opposite-strand | Domain of unknown function (DUF4040) |
4 | PF00662.22 | 1.0 | 7 | 232 | opposite-strand | NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus |
5 | PF04039.15 | 1.0 | 7 | 2630 | opposite-strand | Domain related to MnhB subunit of Na+/H+ antiporter |
6 | PF00420.26 | 1.0 | 7 | 3061 | opposite-strand | NADH-ubiquinone/plastoquinone oxidoreductase chain 4L |
7 | PF01899.18 | 1.0 | 7 | 4882 | opposite-strand | Na+/H+ ion antiporter subunit |