Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YugE |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 3228431 |
Right | 3228691 |
Strand | - |
Nucleotide Sequence | ATGGAAGAAAGTCATGCGGTCAGGGAAATGATTAAGATCATTGCCAAATGGGACCCGTTTAAATATGGAGAAGAGTTTTACGAAACGGAGGCTGTTGATGTCGTGCAGGCAGTCTATGATGAAAACGATCCCGACTTGCTGGCGAAAAGCATTCAGCAAATATTTGAAACTTCTTTTGAACAAACGCTGCCGATCGCCAGCTGCCGGGAAGTGGCTGGCCAGCTTTTATTCATTAAAAACAGCAGCTCCTGCACGCCTTAA |
Sequence | MEESHAVREMIKIIAKWDPFKYGEEFYETEAVDVVQAVYDENDPDLLAKSIQQIFETSFEQTLPIASCREVAGQLLFIKNSSSCTP |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam08958. Profile Description: Domain of unknown function (DUF1871). This set of hypothetical proteins is produced by prokaryotes pertaining to the Bacillus genus. |
Pubmed ID | 9274030 9384377 |
Domain | CDD:401055 |
Functional Category | Others |
Uniprot ID | O05234 |
ORF Length (Amino Acid) | 86 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3228431 | 3228691 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 3034382 | 3034642 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 3092600 | 3092860 | - | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 3095650 | 3095910 | - | NZ_CP033052.1 | Bacillus vallismortis |
5 | 3027417 | 3027677 | - | NZ_CP048852.1 | Bacillus tequilensis |
6 | 3034047 | 3034307 | + | NZ_CP029364.1 | Bacillus halotolerans |
7 | 3015339 | 3015599 | - | NZ_CP051464.1 | Bacillus mojavensis |
8 | 959455 | 959715 | + | NZ_CP011937.1 | Bacillus velezensis |
9 | 3026240 | 3026500 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 2461348 | 2461608 | + | NZ_CP043404.1 | Bacillus safensis |
11 | 2556644 | 2556904 | + | NZ_CP017786.1 | Bacillus xiamenensis |
12 | 3410171 | 3410425 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
13 | 3582551 | 3582805 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
14 | 2848523 | 2848783 | - | NZ_CP011150.1 | Bacillus altitudinis |
15 | 3182705 | 3182959 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
16 | 2773524 | 2773784 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
17 | 732532 | 732765 | + | NZ_CP016020.1 | Bacillus weihaiensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04070.14 | 0.88 | 15 | 3348 | opposite-strand | Domain of unknown function (DUF378) |
2 | PF00575.25 | 1.0 | 17 | 2866 | same-strand | S1 RNA binding domain |
3 | PF00155.23 | 1.0 | 17 | 685 | opposite-strand | Aminotransferase class I and II |
4 | PF01037.23 | 0.94 | 16 | 1000.0 | same-strand | Lrp/AsnC ligand binding domain |
5 | PF13412.8 | 0.94 | 16 | 1000.0 | same-strand | Winged helix-turn-helix DNA-binding |
6 | PF12697.9 | 1.0 | 17 | 27 | opposite-strand | Alpha/beta hydrolase family |
7 | PF12146.10 | 1.0 | 17 | 27 | opposite-strand | Serine aminopeptidase, S33 |
8 | PF02518.28 | 0.76 | 13 | 1377 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
9 | PF00512.27 | 0.76 | 13 | 1377 | opposite-strand | His Kinase A (phospho-acceptor) domain |
10 | PF08810.12 | 1.0 | 17 | 2708 | opposite-strand | Kinase associated protein B |
11 | PF00929.26 | 0.94 | 16 | 3121.0 | same-strand | Exonuclease |