Result : O05234
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YugE |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3228431 |
| Right | 3228691 |
| Strand | - |
| Nucleotide Sequence | ATGGAAGAAAGTCATGCGGTCAGGGAAATGATTAAGATCATTGCCAAATGGGACCCGTTTAAATATGGAGAAGAGTTTTACGAAACGGAGGCTGTTGATGTCGTGCAGGCAGTCTATGATGAAAACGATCCCGACTTGCTGGCGAAAAGCATTCAGCAAATATTTGAAACTTCTTTTGAACAAACGCTGCCGATCGCCAGCTGCCGGGAAGTGGCTGGCCAGCTTTTATTCATTAAAAACAGCAGCTCCTGCACGCCTTAA |
| Sequence | MEESHAVREMIKIIAKWDPFKYGEEFYETEAVDVVQAVYDENDPDLLAKSIQQIFETSFEQTLPIASCREVAGQLLFIKNSSSCTP |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam08958. Profile Description: Domain of unknown function (DUF1871). This set of hypothetical proteins is produced by prokaryotes pertaining to the Bacillus genus. |
| Pubmed ID | 9274030 9384377 |
| Domain | CDD:401055 |
| Functional Category | Others |
| Uniprot ID | O05234 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3228431 | 3228691 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3034382 | 3034642 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 3092600 | 3092860 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 3095650 | 3095910 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 3027417 | 3027677 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 3034047 | 3034307 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 3015339 | 3015599 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 959455 | 959715 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3026240 | 3026500 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2461348 | 2461608 | + | NZ_CP043404.1 | Bacillus safensis |
| 11 | 2556644 | 2556904 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 12 | 3410171 | 3410425 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 3582551 | 3582805 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 14 | 2848523 | 2848783 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 3182705 | 3182959 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 16 | 2773524 | 2773784 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 17 | 732532 | 732765 | + | NZ_CP016020.1 | Bacillus weihaiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04070.14 | 0.88 | 15 | 3348 | opposite-strand | Domain of unknown function (DUF378) |
| 2 | PF00575.25 | 1.0 | 17 | 2866 | same-strand | S1 RNA binding domain |
| 3 | PF00155.23 | 1.0 | 17 | 685 | opposite-strand | Aminotransferase class I and II |
| 4 | PF01037.23 | 0.94 | 16 | 1000.0 | same-strand | Lrp/AsnC ligand binding domain |
| 5 | PF13412.8 | 0.94 | 16 | 1000.0 | same-strand | Winged helix-turn-helix DNA-binding |
| 6 | PF12697.9 | 1.0 | 17 | 27 | opposite-strand | Alpha/beta hydrolase family |
| 7 | PF12146.10 | 1.0 | 17 | 27 | opposite-strand | Serine aminopeptidase, S33 |
| 8 | PF02518.28 | 0.76 | 13 | 1377 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 9 | PF00512.27 | 0.76 | 13 | 1377 | opposite-strand | His Kinase A (phospho-acceptor) domain |
| 10 | PF08810.12 | 1.0 | 17 | 2708 | opposite-strand | Kinase associated protein B |
| 11 | PF00929.26 | 0.94 | 16 | 3121.0 | same-strand | Exonuclease |
++ More..