| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division inhibitor MciZ (FtsZ assembly inhibitor) (Mother cell inhibitor of FtsZ) |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2459141 |
| Right | 2459263 |
| Strand | + |
| Nucleotide Sequence | GTGAAAGTGCACCGCATGCCAAAAGGTGTTGTCTTAGTCGGAAAAGCATGGGAAATTCGAGCGAAGTTAAAAGAGTATGGACGCACATTTCAATATGTGAAAGATTGGATCTCAAAGCCATAA |
| Sequence | MKVHRMPKGVVLVGKAWEIRAKLKEYGRTFQYVKDWISKP |
| Source of smORF | Swiss-Prot |
| Function | Blocks Z-ring formation in the mother cell during sporulation by inhibiting the polymerization of FtsZ (Pubmed:18284588, Pubmed:23237472, Pubmed:25848052). Binds to the minus end of FtsZ and functions as a filament-capping protein (Pubmed:25848052). At high concentrations, is capable of both capping and sequestration of FtsZ (Pubmed:25848052). Decreases the GTPase activity of FtsZ (Pubmed:18284588, Pubmed:23237472, Pubmed:25848052). {ECO:0000269|Pubmed:18284588, ECO:0000269|Pubmed:23237472, ECO:0000269|Pubmed:25848052}. |
| Pubmed ID | 9384377 18284588 23237472 25848052 |
| Domain | CDD:289817 |
| Functional Category | Others |
| Uniprot ID | L8EBJ9 |
| ORF Length (Amino Acid) | 40 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2328540 | 2328662 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 2 | 2332071 | 2332193 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 2459141 | 2459263 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 4 | 2318958 | 2319080 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 2418150 | 2418272 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 3798836 | 3798958 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2255436 | 2255558 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2660590 | 2660712 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 9 | 1658587 | 1658709 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 2341255 | 2341377 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 11 | 2866114 | 2866242 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 12 | 1760868 | 1760996 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 13 | 3942846 | 3942974 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 14 | 4111718 | 4111846 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 15 | 4230168 | 4230308 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 16 | 2824152 | 2824286 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 17 | 1260357 | 1260491 | - | NZ_CP040336.1 | Bacillus luti |
| 18 | 3253748 | 3253888 | + | NZ_CP053989.1 | Niallia circulans |
| 19 | 3972374 | 3972502 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 20 | 4103803 | 4103937 | + | NC_011725.1 | Bacillus cereus B4264 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13263.8 | 0.6 | 12 | 628.0 | opposite-strand | PHP-associated |
| 2 | PF00293.30 | 1.0 | 20 | 75.0 | opposite-strand | NUDIX domain |
| 3 | PF00248.23 | 0.95 | 19 | 63 | same-strand | Aldo/keto reductase family |
| 4 | PF13025.8 | 0.8 | 16 | 1016.5 | opposite-strand | Protein of unknown function (DUF3886) |