Result : L8EAY0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small toxic protein BsrG |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2273594 |
| Right | 2273710 |
| Strand | + |
| Nucleotide Sequence | ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATATAATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG |
| Sequence | MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK |
| Source of smORF | Swiss-Prot |
| Function | Toxic component of a type I toxin-antitoxin (TA) system; expression in the absence of cognate antisense antitoxin SR4 RNA leads to cell lysis (Pubmed:22229825, Pubmed:23969414). Induced expression causes membrane invaginations that dislocate the cell wall synthesis machinery, leading to eventual death. Unlike many type I TA systems it does not form pores (Pubmed:26234942). Base pairing occurs between the 3' UTRs of bsrG mRNA and SR4 RNA, which leads to initiation of degradation by RNase III (rnc) followed by the action of RNase Y (rny) and RNase R (rnr). Not toxic when expressed in E.coli (Pubmed:22229825, Pubmed:23969414). When induced during logarithmic growth it only slowly exerts its toxic effect. Expression during log growth leads to significant disturbances of cell envelope biosynthesis and cell morphology, causing cell membrane invaginations and delocalization of cell division and cell wall synthesis machinery. Cell lysis depends on mreB, lytC and lytD, suggesting expression of bsrG triggers autolysis rather than disintegration of the membrane. Additionally expression of bsrG also inhibits transcription (Pubmed:26234942). {ECO:0000269|Pubmed:22229825, ECO:0000269|Pubmed:23969414, ECO:0000269|Pubmed:26234942}. |
| Pubmed ID | 9384377 18948176 20525796 22229825 23969414 26234942 26802042 |
| Domain | |
| Functional Category | Toxin_type_1 |
| Uniprot ID | L8EAY0 |
| ORF Length (Amino Acid) | 38 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2273594 | 2273710 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1719486 | 1719602 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 2008302 | 2008418 | + | NZ_CP013984.1 | Bacillus inaquosorum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00817.22 | 0.67 | 2 | 2586.0 | opposite-strand | impB/mucB/samB family |
| 2 | PF11799.10 | 0.67 | 2 | 2586.0 | opposite-strand | impB/mucB/samB family C-terminal domain |
| 3 | PF11798.10 | 0.67 | 2 | 2586.0 | opposite-strand | IMS family HHH motif |
| 4 | PF08863.12 | 1.0 | 3 | 2910 | opposite-strand | YolD-like protein |
| 5 | PF14568.8 | 1.0 | 3 | 1555 | opposite-strand | SMI1-KNR4 cell-wall |
| 6 | PF09346.12 | 1.0 | 3 | 1522.5 | opposite-strand | SMI1 / KNR4 family (SUKH-1) |
| 7 | PF04740.14 | 0.67 | 2 | 2311.5 | opposite-strand | LXG domain of WXG superfamily |
++ More..