| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein Rv2386A/RVBD_2386A |
| NCBI Accession ID | CP003248.2 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 2680468 |
| Right | 2680677 |
| Strand | + |
| Nucleotide Sequence | ATGTTCGTAATCCGGCTCGCCGACGGCGAAGAAGTCCACGGCGAGTGCGACGAGCTGACGATTAACCCAGCAACCGGCGTCCTCACGGTCTGCCGGGTCGACGGGTTCGAGGAAACCACCACGCACTACTCGCCGTCGGCGTGGCGGTCGGTGACACACCGCAAGCGGGGGGTCGGCGTTAGACCATCCCTGGTCTCAACTGCTCAATAA |
| Sequence | MFVIRLADGEEVHGECDELTINPATGVLTVCRVDGFEETTTHYSPSAWRSVTHRKRGVGVRPSLVSTAQ |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9634230 21969609 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | I6YD99 |
| ORF Length (Amino Acid) | 69 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2680458 | 2680667 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2739071 | 2739280 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 5834866 | 5835075 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 4 | 4094490 | 4094699 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 5 | 3129310 | 3129519 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 6 | 2629573 | 2629782 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 7 | 1119718 | 1119927 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 8 | 3773679 | 3773888 | + | NZ_LR130759.1 | Mycobacterium basiliense |
| 9 | 2238194 | 2238406 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 10 | 5823046 | 5823252 | - | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 11 | 5579994 | 5580200 | - | NZ_AP022576.1 | Mycobacterium florentinum |
| 12 | 935047 | 935271 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 13 | 2517417 | 2517629 | + | NZ_AP022590.1 | Mycobacterium mantenii |
| 14 | 4523263 | 4523469 | - | NZ_AP022568.1 | Mycobacterium simiae |
| 15 | 3592658 | 3592870 | + | NZ_AP018164.1 | Mycobacterium shigaense |
| 16 | 2363193 | 2363405 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 17 | 4584364 | 4584573 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 18 | 2023848 | 2024063 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 19 | 130243 | 130458 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 20 | 4232450 | 4232653 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 21 | 1693757 | 1693969 | - | NC_016948.1 | Mycobacterium paraintracellulare |
| 22 | 1942506 | 1942706 | - | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 23 | 3523717 | 3523917 | - | NZ_AP022606.1 | Mycobacterium branderi |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00425.20 | 1.0 | 22 | 398.5 | opposite-strand | chorismate binding enzyme |
| 2 | PF05982.14 | 1.0 | 22 | 286.5 | same-strand | Na+-dependent bicarbonate transporter superfamily |
| 3 | PF04055.23 | 0.91 | 20 | 1532.0 | opposite-strand | Radical SAM superfamily |
| 4 | PF01077.24 | 0.82 | 18 | 3156.5 | same-strand | Nitrite and sulphite reductase 4Fe-4S domain |
| 5 | PF03460.19 | 0.82 | 18 | 3156.5 | same-strand | Nitrite/Sulfite reductase ferredoxin-like half domain |
| 6 | PF01507.21 | 0.73 | 16 | 4814.5 | same-strand | Phosphoadenosine phosphosulfate reductase family |
| 7 | PF13411.8 | 0.68 | 15 | 2962 | same-strand | MerR HTH family regulatory protein |