Protein Information |
Information Type | Description |
---|---|
Protein name | PE-PGRS family protein PE25 |
NCBI Accession ID | AL123456.3 |
Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
Left | 2727967 |
Right | 2728266 |
Strand | - |
Nucleotide Sequence | ATGTCTTTTGTGATCACAAATCCCGAGGCGTTGACCGTGGCGGCCACGGAGGTACGACGGATTCGCGATCGTGCGATCCAAAGCGATGCTCAGGTGGCCCCGATGACAACCGCTGTGCGGCCTCCGGCTGCGGATCTGGTGTCGGAGAAGGCGGCGACGTTCCTGGTCGAGTACGCAAGGAAGTATCGGCAGACCATCGCTGCGGCGGCGGTGGTTCTTGAGGAGTTTGCGCACGCCTTGACCACTGGCGCCGATAAGTATGCGACCGCCGAGGCCGACAACATCAAGACCTTTAGTTAA |
Sequence | MSFVITNPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYATAEADNIKTFS |
Source of smORF | Swiss-Prot |
Function | The PE25/PPE41 dimer induces both a strong humoral and cellular immune response. PE25 protein alone induces low response (Pubmed:18974870). The dimer induces necrosis, but not apoptosis, in mouse macrophage cells (Pubmed:25379378). It also induces activation and maturation of mouse dendritic cells and drives Th2-biased immune responses (Pubmed:26318856). {ECO:0000269|Pubmed:18974870, ECO:0000269|Pubmed:25379378, ECO:0000269|Pubmed:26318856}. |
Pubmed ID | 9634230 18974870 21969609 25379378 26318856 16690741 25155747 25275011 |
Domain | CDD:395748 |
Functional Category | Others |
Uniprot ID | I6X486 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2727967 | 2728266 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 2791230 | 2791529 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
3 | 3626621 | 3626920 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
4 | 3715989 | 3716315 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
5 | 3722422 | 3722745 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
6 | 3650965 | 3651213 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
7 | 3659551 | 3659868 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
8 | 3158852 | 3159151 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
9 | 3724085 | 3724405 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
10 | 3654952 | 3655251 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
11 | 3719866 | 3720189 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
12 | 3663959 | 3664276 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
13 | 3713137 | 3713460 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
14 | 3720900 | 3721169 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
15 | 3161244 | 3161543 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00578.23 | 0.67 | 2 | 1187.0 | opposite-strand | AhpC/TSA family |
2 | PF08534.12 | 0.67 | 2 | 1187.0 | opposite-strand | Redoxin |
3 | PF02627.22 | 1.0 | 3 | 628 | opposite-strand | Carboxymuconolactone decarboxylase family |
4 | PF00823.21 | 1.0 | 3 | 1170.0 | same-strand | PPE family |
5 | PF00924.20 | 0.67 | 2 | 849.0 | same-strand | Mechanosensitive ion channel |
6 | PF00027.31 | 0.67 | 2 | 849.0 | same-strand | Cyclic nucleotide-binding domain |
7 | PF00211.22 | 0.67 | 2 | 2291.0 | same-strand | Adenylate and Guanylate cyclase catalytic domain |
8 | PF00672.27 | 0.67 | 2 | 2291.0 | same-strand | HAMP domain |
9 | PF00294.26 | 0.67 | 2 | 4964.0 | opposite-strand | pfkB family carbohydrate kinase |
10 | PF04191.15 | 0.67 | 2 | 6092.0 | opposite-strand | Phospholipid methyltransferase |
11 | PF04140.16 | 0.67 | 2 | 6092.0 | opposite-strand | Isoprenylcysteine carboxyl methyltransferase (ICMT) family |