Result : I6WXS6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin VapB51 |
| NCBI Accession ID | CP003248.2 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 274710 |
| Right | 274904 |
| Strand | - |
| Nucleotide Sequence | ATGGCGAAACATCTCGTCGACATCGACGAGCAGGCTTTAAACATGGCTCGTACAGAATTGGGCACGACGACGATCAAAGACACCGTCAACGCGGCCCTGCGGCAAGCCACGTCTCAGCGAGTTCAACGCGTCGCCGCCGCTCTCGACACGCTGGCCGCCGCACCGCCAGAGGACCGCGCCGAAGCATGGCGCTGA |
| Sequence | MAKHLVDIDEQALNMARTELGTTTIKDTVNAALRQATSQRVQRVAAALDTLAAAPPEDRAEAWR |
| Source of smORF | Swiss-Prot |
| Function | Possibly the antitoxin component of a type II toxin-antitoxin (TA) system. Its cognate toxin is VapC51. {ECO:0000305}. |
| Pubmed ID | 9634230 21969609 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | I6WXS6 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 274710 | 274904 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 281468 | 281662 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 4239810 | 4240004 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 4 | 1789229 | 1789435 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 1.0 | 4 | -9.0 | same-strand | PIN domain |
| 2 | PF00441.26 | 0.75 | 3 | 2007.0 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 3 | PF00440.25 | 0.75 | 3 | 2995 | opposite-strand | Bacterial regulatory proteins, tetR family |
++ More..