Protein Information |
Information Type | Description |
---|---|
Protein name | Light-harvesting protein B-870 alpha chain (Antenna pigment protein alpha chain) (Light-harvesting protein B-875 alpha chain) |
NCBI Accession ID | D16822.1 |
Organism | Rubrivivax gelatinosus (strain NBRC 100245 / IL144) |
Left | 894 |
Right | 1097 |
Strand | + |
Nucleotide Sequence | ATGTGGAGAATTTGGCGTCTGTTCGATCCGATGCGCGCCATGGTGGCCCAGGCGGTGTTCCTTCTCGGTCTCGCCGTTCTGATTCACCTGATGCTGCTGGGCACGAACAAGTACAACTGGCTGGACGGCGCGAAGAAGGCGCCGGTGGCGACGGCTGTCGCTCCGGTTCCTGCCGAAGTGACGTCCCTGGCGCAGGCGAAGTAA |
Sequence | MWRIWRLFDPMRAMVAQAVFLLGLAVLIHLMLLGTNKYNWLDGAKKAPVATAVAPVPAEVTSLAQAK |
Source of smORF | Swiss-Prot |
Function | Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers. |
Pubmed ID | 8300574 22689232 |
Domain | CDD:395441 |
Functional Category | Metal-binding |
Uniprot ID | I0HUL6 |
ORF Length (Amino Acid) | 67 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1236896 | 1237096 | + | NZ_CP019240.1 | Rhodoferax antarcticus |
2 | 6695796 | 6695984 | - | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
3 | 5112746 | 5112937 | - | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
4 | 5158079 | 5158270 | + | NZ_CP044543.1 | Bradyrhizobium betae |
5 | 2019131 | 2019322 | + | NC_017082.1 | Bradyrhizobium cosmicum |
6 | 1608401 | 1608592 | + | NZ_CP058907.1 | Rhodopseudomonas palustris |
7 | 1882339 | 1882530 | + | NZ_CP030265.1 | Skermanella pratensis |
8 | 6685152 | 6685337 | - | NZ_CP029550.1 | Methylobacterium durans |
9 | 542386 | 542574 | + | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
10 | 1799815 | 1799991 | - | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00148.21 | 1.0 | 10 | 1847 | same-strand | Nitrogenase component 1 type Oxidoreductase |
2 | PF08369.12 | 1.0 | 10 | 661.0 | same-strand | Proto-chlorophyllide reductase 57 kD subunit |
3 | PF00556.22 | 1.0 | 10 | 14.5 | same-strand | Antenna complex alpha/beta subunit |
4 | PF00124.21 | 1.0 | 10 | 607.0 | same-strand | Photosynthetic reaction centre protein |
5 | PF02954.21 | 0.6 | 6 | 2168.5 | same-strand | Bacterial regulatory protein, Fis family |
6 | PF00142.20 | 0.9 | 9 | 3727 | same-strand | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family |
7 | PF01656.25 | 0.9 | 9 | 3727 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
8 | PF10609.11 | 0.6 | 6 | 3712.5 | same-strand | NUBPL iron-transfer P-loop NTPase |