Result : H2A7G5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Lantibiotic macedovicin |
| NCBI Accession ID | HE613569.1 |
| Organism | Streptococcus macedonicus (strain ACA-DC 198) |
| Left | 1374591 |
| Right | 1374767 |
| Strand | - |
| Nucleotide Sequence | ATGATGAATGCTACTGAAAACCAAATTTTTGTTGAGACTGTGAGTGACCAAGAATTAGAAATGTTAATTGGTGGTGCAGATCGTGGATGGATTAAGACTTTAACAAAAGATTGTCCAAATGTAATTTCTTCAATTTGTGCAGGTACAATTATTACAGCTTGTAAAAATTGTGCTTAA |
| Sequence | MMNATENQIFVETVSDQELEMLIGGADRGWIKTLTKDCPNVISSICAGTIITACKNCA |
| Source of smORF | Swiss-Prot |
| Function | Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. Macedovicin inhibits a broad spectrum of lactic acid bacteria, several food spoilage species (e.g. Clostridium spp.) and oral streptococci (Pubmed:23122510). The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores. {ECO:0000269|Pubmed:23122510, ECO:0000305}. |
| Pubmed ID | 22408241 23122510 |
| Domain | CDD:368018 |
| Functional Category | Antimicrobial |
| Uniprot ID | H2A7G5 |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1199889 | 1200065 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 2 | 932836 | 933009 | - | NC_012924.1 | Streptococcus suis SC84 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP018400.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13575.8 | 1.0 | 2 | 88.5 | same-strand | Domain of unknown function (DUF4135) |
++ More..