Result : E6Z0R4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VbhA |
| NCBI Accession ID | FN645515.1 |
| Organism | Bartonella schoenbuchensis (strain DSM 13525 / NCTC 13165 / R1) |
| Left | 20860 |
| Right | 21048 |
| Strand | - |
| Nucleotide Sequence | ATGTTGAGCGAGGAAGAAATCGAATACCGTCGCCGTGATGCTAGAAATGCGTTGGCTAGTCAACGTTTAGAGGGTTTGGAACCAGATCCACAAGTCGTTGCACAAATGGAGCGTGTTGTTGTTGGAGAGCTTGAAACAAGTGATGTAATCAAGGATTTGATGGAACGGATAAAACGTGAGGAAATATGA |
| Sequence | MLSEEEIEYRRRDARNALASQRLEGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREEI |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of type II toxin-antitoxin (TA) system VbhT-VbhA. Acts by inhibiting the adenylyltransferase activity of VbhT; competes with ATP-binding and prevents productive ATP-binding to VbhT. {ECO:0000269|Pubmed:22266942}. |
| Pubmed ID | 21347280 22266942 |
| Domain | CDD:418392 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | E6Z0R4 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2305636 | 2305824 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 2 | 35337 | 35525 | - | NZ_CP031843.2 | Bartonella kosoyi |
| 3 | 16319 | 16507 | - | NC_012847.1 | Bartonella grahamii as4aup |
| 4 | 1748176 | 1748364 | - | NZ_CP031844.2 | Bartonella krasnovii |
| 5 | 1617571 | 1617759 | - | NZ_LR134527.1 | Bartonella elizabethae |
| 6 | 2083623 | 2083811 | - | NC_012846.1 | Bartonella grahamii as4aup |
| 7 | 6363 | 6560 | + | NZ_CP046571.1 | Xanthomonas albilineans |
| 8 | 39408 | 39596 | + | NZ_CP016879.1 | Xanthomonas hortorum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010161.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02661.20 | 1.0 | 7 | -13.0 | same-strand | Fic/DOC family |
| 2 | PF02878.18 | 0.71 | 5 | 1245 | same-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I |
| 3 | PF02880.18 | 0.71 | 5 | 1245 | same-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III |
| 4 | PF02879.18 | 0.71 | 5 | 1245 | same-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II |
| 5 | PF00408.22 | 0.71 | 5 | 1245 | same-strand | Phosphoglucomutase/phosphomannomutase, C-terminal domain |
++ More..