Protein Information |
Information Type | Description |
---|---|
Protein name | Antitoxin VbhA |
NCBI Accession ID | FN645515.1 |
Organism | Bartonella schoenbuchensis (strain DSM 13525 / NCTC 13165 / R1) |
Left | 20860 |
Right | 21048 |
Strand | - |
Nucleotide Sequence | ATGTTGAGCGAGGAAGAAATCGAATACCGTCGCCGTGATGCTAGAAATGCGTTGGCTAGTCAACGTTTAGAGGGTTTGGAACCAGATCCACAAGTCGTTGCACAAATGGAGCGTGTTGTTGTTGGAGAGCTTGAAACAAGTGATGTAATCAAGGATTTGATGGAACGGATAAAACGTGAGGAAATATGA |
Sequence | MLSEEEIEYRRRDARNALASQRLEGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREEI |
Source of smORF | Swiss-Prot |
Function | Antitoxin component of type II toxin-antitoxin (TA) system VbhT-VbhA. Acts by inhibiting the adenylyltransferase activity of VbhT; competes with ATP-binding and prevents productive ATP-binding to VbhT. {ECO:0000269|Pubmed:22266942}. |
Pubmed ID | 21347280 22266942 |
Domain | CDD:418392 |
Functional Category | Antitoxin_type_2 |
Uniprot ID | E6Z0R4 |
ORF Length (Amino Acid) | 62 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2305636 | 2305824 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
2 | 35337 | 35525 | - | NZ_CP031843.2 | Bartonella kosoyi |
3 | 16319 | 16507 | - | NC_012847.1 | Bartonella grahamii as4aup |
4 | 1748176 | 1748364 | - | NZ_CP031844.2 | Bartonella krasnovii |
5 | 1617571 | 1617759 | - | NZ_LR134527.1 | Bartonella elizabethae |
6 | 2083623 | 2083811 | - | NC_012846.1 | Bartonella grahamii as4aup |
7 | 6363 | 6560 | + | NZ_CP046571.1 | Xanthomonas albilineans |
8 | 39408 | 39596 | + | NZ_CP016879.1 | Xanthomonas hortorum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02661.20 | 1.0 | 7 | -13.0 | same-strand | Fic/DOC family |
2 | PF02878.18 | 0.71 | 5 | 1245 | same-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I |
3 | PF02880.18 | 0.71 | 5 | 1245 | same-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III |
4 | PF02879.18 | 0.71 | 5 | 1245 | same-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II |
5 | PF00408.22 | 0.71 | 5 | 1245 | same-strand | Phosphoglucomutase/phosphomannomutase, C-terminal domain |